Rendered PDF File Page 2 of 9 GE Healthcare Released BRIVO XR115 Mobile Radiographic System Data Sheet DOC1138106, R

GE Healthcare OEC Brivo Plus Digital Mobile C-arm Technical Data Adding more to your surgical imaging capabilities. Ad

GE MRI PARTS 2294300-4 APS PCB. 936,48 € - 1.872,95 €. Ordine minimo: 1 parte.

Relation: Zone industrielle Le Haut Coudray ( 2281038 ). Version #2. decheterie et landuse. Edited over 6 years ago by Olyon; Changeset #59520548. Tags. landuse ...

Need CT parts now? Click here to request pricing and availability. GE Image Generator Comparison. The Cost. Westville IG for GE CT: P/N 2362872.

2364354 / 2364355 GDAS converter board CT GE Lightspeed · 2395043 GOC AUDIO BOX for GE CT.

GE Healthcare gehealthcare.com Technical  Publication Direction 5429575-CA-1EN Version 7 GE Healthcare Brivo XR575 Service Manual(Class A) Copyright © 2015 by General Electric Company, Inc. All Rights Reserved GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 2  INSTALLATION MANUAL  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL LEGAL NOTES TRADEMARKS All other products and their name brands are the trademarks of their respective holders. COPYRIGHTS All Material, Copyright © 2015 by General Electric Company, Inc. All rights reserved. The material presented and contained herein may not be reproduced in any form or manner, without the written permission of General Electric Company, Inc. Legal Notes Page 3  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL This page is intentionally left blank. Page 4 Legal Notes  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL IMPORTANT PRECAUTIONS LANGUAGE ПРЕДУПРЕЖДЕНИЕ (BG)  ТО В А УП Ъ ТВ А Н Е ЗА РА Б О ТА Е Н А Л И Ч Н О С А М О Н А А Н ГЛ И Й С КИ Е ЗИ К.  А КО Д О С ТА В Ч И КЪ Т Н А УС Л УГА ТА Н А КЛИ ЕН ТА И З И С КА ЕЗИ К, РА З Л И Ч ЕН О Т А Н ГЛ И Й С КИ , ЗА Д Ъ Л Ж ЕН И Е Н А КЛ И ЕН ТА Е Д А О С И ГУРИ П РЕ В О Д .  Н Е И ЗП О Л ЗВ А Й ТЕ О Б О РУД В А Н ЕТО П РЕД И Д А С ТЕ С Е КО Н С УЛ ТИ РА Л И И РА ЗБ РА ЛИ УП Ъ ТВ А Н ЕТО ЗА РА Б О ТА .  Н ЕС П А ЗВ А Н ЕТО Н А ТО В А П РЕД УП РЕЖ Д ЕН И Е М О Ж Е Д А Д О В ЕД Е Д О Н А РА Н Я В А Н Е Н А Д О С ТА В Ч И КА Н А УС ЛУГА ТА , О П ЕРА ТО РА И Л И П А Ц И ЕН Т В РЕЗУЛ ТА Т Н А ТО КО В УД А Р И Л И М ЕХА Н И ЧН А И Л И Д РУ ГА О П А С Н О С Т. 警告 (ZH-CN)  本维修手册仅提供英文版本。  如果维修服务提供商需要非英文版本,客户需自行提供翻译服务。  未详细阅读和完全理解本维修手册之前,不得进行维修。  忽略本警告可能对维修人员,操作员或患者造成触电、机械伤害或其他形式的伤害。 VÝSTRAHA (CS)  TENTO PROVOZNÍ NÁVOD EXISTUJE POUZE V ANGLICKÉM JAZYCE.  V PŘÍPADĚ, ŽE EXTERNÍ SLUŽBA ZÁKAZNÍKŮM POTŘEBUJE NÁVOD V JINÉM JAZYCE, JE ZAJIŠTĚNÍ PŘEKLADU DO ODPOVÍDAJÍCÍHO JAZYKA ÚKOLEM ZÁKAZNÍKA.  NESNAŽTE SE O ÚDRŽBU TOHOTO ZAŘÍZENÍ, ANIŽ BYSTE SI PŘEČETLI TENTO PROVOZNÍ NÁVOD A POCHOPILI JEHO OBSAH.  V PŘÍPADĚ NEDODRŽOVÁNÍ TÉTO VÝSTRAHY MŮŽE DOJÍT K PORANĚNÍ PRACOVNÍKA PRODEJNÍHO SERVISU, OBSLUŽNÉHO PERSONÁLU NEBO PACIENTŮ VLIVEM ELEKTRICKÉHOP PROUDU, RESPEKTIVE VLIVEM MECHANICKÝCH ČI JINÝCH RIZIK. ADVARSEL (DA)  DENNE SERVICEMANUAL FINDES KUN PÅ ENGELSK.  HVIS EN KUNDES TEKNIKER HAR BRUG FOR ET ANDET SPROG END ENGELSK, ER DET KUNDENS ANSVAR AT SØRGE FOR OVERSÆTTELSE.  FORSØG IKKE AT SERVICERE UDSTYRET MEDMINDRE DENNE SERVICEMANUAL HAR VÆRET KONSULTERET OG ER FORSTÅET.  MANGLENDE OVERHOLDELSE AF DENNE ADVARSEL KAN MEDFØRE SKADE PÅ GRUND AF ELEKTRISK, MEKANISK ELLER ANDEN FARE FOR TEKNIKEREN, OPERATØREN ELLER PATIENTEN. Important Precautions Page 5  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 WAARSCHUWING (NL) INSTALLATION MANUAL  DEZE ONDERHOUDSHANDLEIDING IS ENKEL IN HET ENGELS VERKRIJGBAAR.  ALS HET ONDERHOUDSPERSONEEL EEN ANDERE TAAL VEREIST, DAN IS DE KLANT VERANTWOORDELIJK VOOR DE VERTALING ERVAN.  PROBEER DE APPARATUUR NIET TE ONDERHOUDEN VOORDAT DEZE ONDERHOUDSHANDLEIDING WERD GERAADPLEEGD EN BEGREPEN IS.  INDIEN DEZE WAARSCHUWING NIET WORDT OPGEVOLGD, ZOU HET ONDERHOUDSPERSONEEL, DE OPERATOR OF EEN PATIËNT GEWOND KUNNEN RAKEN ALS GEVOLG VAN EEN ELEKTRISCHE SCHOK, MECHANISCHE OF ANDERE GEVAREN. WARNING (EN) • • • • HOIATUS (ET) THIS SERVICE MANUAL IS AVAILABLE IN ENGLISH ONLY. IF A CUSTOMER’S SERVICE PROVIDER REQUIRES A LANGUAGE OTHER THAN ENGLISH, IT IS THE CUSTOMER’S RESPONSIBILITY TO PROVIDE TRANSLATION SERVICES. DO NOT ATTEMPT TO SERVICE THE EQUIPMENT UNLESS THIS SERVICE MANUAL HAS BEEN CONSULTED AND IS UNDERSTOOD. FAILURE TO HEED THIS WARNING MAY RESULT IN INJURY TO THE SERVICE PROVIDER, OPERATOR OR PATIENT FROM ELECTRIC SHOCK, MECHANICAL OR OTHER HAZARDS.  KÄESOLEV TEENINDUSJUHEND ON SAADAVAL AINULT INGLISE KEELES.  KUI KLIENDITEENINDUSE OSUTAJA NÕUAB JUHENDIT INGLISE KEELEST ERINEVAS KEELES, VASTUTAB KLIENT TÕLKETEENUSE OSUTAMISE EEST.  ÄRGE ÜRITAGE SEADMEID TEENINDADA ENNE EELNEVALT KÄESOLEVA TEENINDUSJUHENDIGA TUTVUMIST JA SELLEST ARU SAAMIST.  KÄESOLEVA HOIATUSE EIRAMINE VÕIB PÕHJUSTADA TEENUSEOSUTAJA, OPERAATORI VÕI PATSIENDI VIGASTAMIST ELEKTRILÖÖGI, MEHAANILISE VÕI MUU OHU TAGAJÄRJEL. VAROITUS (FI)  TÄMÄ HUOLTO-OHJE ON SAATAVILLA VAIN ENGLANNIKSI.  JOS ASIAKKAAN HUOLTOHENKILÖSTÖ VAATII MUUTA KUIN ENGLANNINKIELISTÄ MATERIAALIA, TARVITTAVAN KÄÄNNÖKSEN HANKKIMINEN ON ASIAKKAAN VASTUULLA.  ÄLÄ YRITÄ KORJATA LAITTEISTOA ENNEN KUIN OLET VARMASTI LUKENUT JA YMMÄRTÄNYT TÄMÄN HUOLTO-OHJEEN.  MIKÄLI TÄTÄ VAROITUSTA EI NOUDATETA, SEURAUKSENA VOI OLLA HUOLTOHENKILÖSTÖN, LAITTEISTON KÄYTTÄJÄN TAI POTILAAN VAHINGOITTUMINEN SÄHKÖISKUN, MEKAANISEN VIAN TAI MUUN VAARATILANTEEN VUOKSI. Page 6 Important Precautions  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 ATTENTION (FR) • • • • WARNUNG (DE) INSTALLATION MANUAL CE MANUEL DE MAINTENANCE N’EST DISPONIBLE QU’EN ANGLAIS. SI LE TECHNICIEN DU CLIENT A BESOIN DE CE MANUEL DANS UNE AUTRE LANGUE QUE L’ANGLAIS, C’EST AU CLIENT QU’IL INCOMBE DE LE FAIRE TRADUIRE. NE PAS TENTER D’INTERVENTION SUR LES ÉQUIPEMENTS TANT QUE LE MANUEL SERVICE N’A PAS ÉTÉ CONSULTÉ ET COMPRIS. LE NON-RESPECT DE CET AVERTISSEMENT PEUT ENTRAÎNER CHEZ LE TECHNICIEN, L’OPÉRATEUR OU LE PATIENT DES BLESSURES DUES À DES DANGERS ÉLECTRIQUES, MÉCANIQUES OU AUTRES.  DIESE SERVICEANLEITUNG EXISTIERT NUR IN ENGLISCHER SPRACHE.  FALLS EIN FREMDER KUNDENDIENST EINE ANDERE SPRACHE BENÖTIGT, IST ES AUFGABE DES KUNDEN FÜR EINE ENTSPRECHENDE ÜBERSETZUNG ZU SORGEN.  VERSUCHEN SIE NICHT DIESE ANLAGE ZU WARTEN, OHNE DIESE SERVICEANLEITUNG GELESEN UND VERSTANDEN ZU HABEN.  WIRD DIESE WARNUNG NICHT BEACHTET, SO KANN ES ZU VERLETZUNGEN DES KUNDENDIENSTTECHNIKERS, DES BEDIENERS ODER DES PATIENTEN DURCH STROMSCHLÄGE, MECHANISCHE ODER SONSTIGE GEFAHREN KOMMEN. ΠΡΟΕΙ∆ΟΠΟΙΗΣΗ (EL)  ΤΟ ΠΑΡΟΝ ΕΓΧΕΙΡΙ∆ΙΟ ΣΕΡΒΙΣ ∆ΙΑΤΙΘΕΤΑΙ ΣΤΑ ΑΓΓΛΙΚΑ ΜΟΝΟ.  ΕΑΝ ΤΟ ΑΤΟΜΟ ΠΑΡΟΧΗΣ ΣΕΡΒΙΣ ΕΝΟΣ ΠΕΛΑΤΗ ΑΠΑΙΤΕΙ ΤΟ ΠΑΡΟΝ ΕΓΧΕΙΡΙ∆ΙΟ ΣΕ ΓΛΩΣΣΑ ΕΚΤΟΣ ΤΩΝ ΑΓΓΛΙΚΩΝ, ΑΠΟΤΕΛΕΙ ΕΥΘΥΝΗ ΤΟΥ ΠΕΛΑΤΗ ΝΑ ΠΑΡΕΧΕΙ ΥΠΗΡΕΣΙΕΣ ΜΕΤΑΦΡΑΣΗΣ.  ΜΗΝ ΕΠΙΧΕΙΡΗΣΕΤΕ ΤΗΝ ΕΚΤΕΛΕΣΗ ΕΡΓΑΣΙΩΝ ΣΕΡΒΙΣ ΣΤΟΝ ΕΞΟΠΛΙΣΜΟ ΕΚΤΟΣ ΕΑΝ ΕΧΕΤΕ ΣΥΜΒΟΥΛΕΥΤΕΙ ΚΑΙ ΕΧΕΤΕ ΚΑΤΑΝΟΗΣΕΙ ΤΟ ΠΑΡΟΝ ΕΓΧΕΙΡΙ∆ΙΟ ΣΕΡΒΙΣ.  ΕΑΝ ∆Ε ΛΑΒΕΤΕ ΥΠΟΨΗ ΤΗΝ ΠΡΟΕΙ∆ΟΠΟΙΗΣΗ ΑΥΤΗ, ΕΝ∆ΕΧΕΤΑΙ ΝΑ ΠΡΟΚΛΗΘΕΙ ΤΡΑΥΜΑΤΙΣΜΟΣ ΣΤΟ ΑΤΟΜΟ ΠΑΡΟΧΗΣ ΣΕΡΒΙΣ, ΣΤΟ ΧΕΙΡΙΣΤΗ Ή ΣΤΟΝ ΑΣΘΕΝΗ ΑΠΟ ΗΛΕΚΤΡΟΠΛΗΞΙΑ, ΜΗΧΑΝΙΚΟΥΣ Ή ΑΛΛΟΥΣ ΚΙΝ∆ΥΝΟΥΣ. FIGYELMEZTETÉS (HU)  EZEN KARBANTARTÁSI KÉZIKÖNYV KIZÁRÓLAG ANGOL NYELVEN ÉRHETŐ EL.  HA A VEVŐ SZOLGÁLTATÓJA ANGOLTÓL ELTÉRŐ NYELVRE TART IGÉNYT, AKKOR A VEVŐ FELELŐSSÉGE A FORDÍTÁS ELKÉSZÍTTETÉSE.  NE PRÓBÁLJA ELKEZDENI HASZNÁLNI A BERENDEZÉST, AMÍG A KARBANTARTÁSI KÉZIKÖNYVBEN LEÍRTAKAT NEM ÉRTELMEZTÉK.  EZEN FIGYELMEZTETÉS FIGYELMEN KÍVÜL HAGYÁSA A SZOLGÁLTATÓ, MŰKÖDTETŐ VAGY A BETEG ÁRAMÜTÉS, MECHANIKAI VAGY EGYÉB VESZÉLYHELYZET MIATTI SÉRÜLÉSÉT EREDMÉNYEZHETI. Important Precautions Page 7  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AÐVÖRUN (IS) INSTALLATION MANUAL  ÞESSI ÞJÓNUSTUHANDBÓK ER EINGÖNGU FÁANLEG Á ENSKU.  EF AÐ ÞJÓNUSTUVEITANDI VIÐSKIPTAMANNS ÞARFNAST ANNAS TUNGUMÁLS EN ENSKU, ER ÞAÐ SKYLDA VIÐSKIPTAMANNS AÐ SKAFFA TUNGUMÁLAÞJÓNUSTU.  REYNIÐ EKKI AÐ AFGREIÐA TÆKIÐ NEMA AÐ ÞESSI ÞJÓNUSTUHANDBÓK HEFUR VERIÐ SKOÐUÐ OG SKILIN.  BROT Á SINNA ÞESSARI AÐVÖRUN GETUR LEITT TIL MEIÐSLA Á ÞJÓNUSTUVEITANDA, STJÓRNANDA EÐA SJÚKLINGS FRÁ RAFLOSTI, VÉLRÆNU EÐA ÖÐRUM ÁHÆTTUM. AVVERTENZA • (IT) • • • IL PRESENTE MANUALE DI MANUTENZIONE È DISPONIBILE SOLTANTO IN INGLESE. SE UN ADDETTO ALLA MANUTENZIONE ESTERNO ALLA GEMS RICHIEDE IL MANUALE IN UNA LINGUA DIVERSA, IL CLIENTE È TENUTO A PROVVEDERE DIRETTAMENTE ALLA TRADUZIONE. SI PROCEDA ALLA MANUTENZIONE DELL’APPARECCHIATURA SOLO DOPO AVER CONSULTATO IL PRESENTE MANUALE ED AVERNE COMPRESO IL CONTENUTO. IL NON RISPETTO DELLA PRESENTE AVVERTENZA POTREBBE FAR COMPIERE OPERAZIONI DA CUI DERIVINO LESIONI ALL’ADDETTO ALLA MANUTENZIONE, ALL’UTILIZZATORE ED AL PAZIENTE PER FOLGORAZIONE ELETTRICA, PER URTI MECCANICI OD ALTRI RISCHI.  このサービスマニュアルには英語版しかありません。 (JA)  サービスを担当される業者が英語以外の言語を要求される場合、翻訳作業はその業 者の責任で行うものとさせていただきます。  このサービスマニュアルを熟読し理解せずに、装置のサービスを行わないでくださ い。  この警告に従わない場合、サービスを担当される方、操作員あるいは患者さんが、 感電や機械的又はその他の危険により負傷する可能性があります。 Page 8 Important Precautions  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 경고 (KO) INSTALLATION MANUAL  본 서비스 지침서는 영어로만 이용하실 수 있습니다.  고객의 서비스 제공자가 영어 이외의 언어를 요구할 경우, 번역 서비스를 제공하는 것 은 고객의 책임입니다.  본 서비스 지침서를 참고했고 이해하지 않는 한은 해당 장비를 수리하려고 시도하지 마십시오.  이 경고에 유의하지 않으면 전기 쇼크, 기계상의 혹은 다른 위험으로부터 서비스 제공 자, 운영자 혹은 환자에게 위해를 가할 수 있습니다. BRĪDINĀJUMS (LV)  ŠĪ APKALPES ROKASGRĀMATA IR PIEEJAMA TIKAI ANGĻU VALODĀ.  JA KLIENTA APKALPES SNIEDZĒJAM NEPIECIEŠAMA INFORMĀCIJA CITĀ VALODĀ, NEVIS ANGĻU, KLIENTA PIENĀKUMS IR NODROŠINĀT TULKOŠANU.  NEVEICIET APRĪKOJUMA APKALPI BEZ APKALPES ROKASGRĀMATAS IZLASĪŠANAS UN SAPRAŠANAS.  ŠĪ BRĪDINĀJUMA NEIEVĒROŠANA VAR RADĪT ELEKTRISKĀS STRĀVAS TRIECIENA, MEHĀNISKU VAI CITU RISKU IZRAISĪTU TRAUMU APKALPES SNIEDZĒJAM, OPERATORAM VAI PACIENTAM. ĮSPĖJIMAS (LT)  ŠIS EKSPLOATAVIMO VADOVAS YRA PRIEINAMAS TIK ANGLŲ KALBA.  JEI KLIENTO PASLAUGŲ TIEKĖJAS REIKALAUJA VADOVO KITA KALBA – NE ANGLŲ, NUMATYTI VERTIMO PASLAUGAS YRA KLIENTO ATSAKOMYBĖ.  NEMĖGINKITE ATLIKTI ĮRANGOS TECHNINĖS PRIEŽIŪROS, NEBENT ATSIŽVELGĖTE Į ŠĮ EKSPLOATAVIMO VADOVĄ IR JĮ SUPRATOTE.  JEI NEATKREIPSITE DĖMESIO Į ŠĮ PERSPĖJIMĄ, GALIMI SUŽALOJIMAI DĖL ELEKTROS ŠOKO.  MECHANINIŲ AR KITŲ PAVOJŲ PASLAUGŲ TIEKĖJUI, OPERATORIUI AR PACIENTUI. ADVARSEL (NO)  DENNE SERVICEHÅNDBOKEN FINNES BARE PÅ ENGELSK.  HVIS KUNDENS SERVICELEVERANDØR TRENGER ET ANNET SPRÅK, ER DET KUNDENS ANSVAR Å SØRGE FOR OVERSETTELSE.  IKKE FORSØK Å REPARERE UTSTYRET UTEN AT DENNE SERVICEHÅNDBOKEN ER LEST OG FORSTÅTT.  MANGLENDE HENSYN TIL DENNE ADVARSELEN KAN FØRE TIL AT SERVICELEVERANDØREN, OPERATØREN ELLER PASIENTEN SKADES PÅ GRUNN AV ELEKTRISK STØT, MEKANISKE ELLER ANDRE FARER. Important Precautions Page 9  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 OSTRZEŻENIE (PL) INSTALLATION MANUAL  NINIEJSZY PODRĘCZNIK SERWISOWY DOSTĘPNY JEST JEDYNIE W JĘZYKU ANGIELSKIM.  JEŚLI DOSTAWCA USŁUG KLIENTA WYMAGA JĘZYKA INNEGO NIŻ ANGIELSKI, ZAPEWNIENIE USŁUGI TŁUMACZENIA JEST OBOWIĄZKIEM KLIENTA.  NIE PRÓBOWAĆ SERWISOWAĆ WYPOSAŻENIA BEZ ZAPOZNANIA SIĘ I ZROZUMIENIA NINIEJSZEGO PODRĘCZNIKA SERWISOWEGO.  NIEZASTOSOWANIE SIĘ DO TEGO OSTRZEŻENIA MOŻE SPOWODOWAĆ URAZY DOSTAWCY USŁUG, OPERATORA LUB PACJENTA W WYNIKU PORAŻENIA ELEKTRYCZNEGO, ZAGROŻENIA MECHANICZNEGO BĄDŹ INNEGO. ATENÇÃO (PT)  ESTE MANUAL DE ASSISTÊNCIA TÉCNICA SÓ SE ENCONTRA DISPONÍVEL EM INGLÊS.  SE QUALQUER OUTRO SERVIÇO DE ASSISTÊNCIA TÉCNICA, QUE NÃO A GEMS, SOLICITAR ESTES MANUAIS NOUTRO IDIOMA, É DA RESPONSABILIDADE DO CLIENTE FORNECER OS SERVIÇOS DE TRADUÇÃO.  NÃO TENTE REPARAR O EQUIPAMENTO SEM TER CONSULTADO E COMPREENDIDO ESTE MANUAL DE ASSISTÉNCIA TÉCNICA  O NÃO CUMPRIMENTO DESTE AVISO PODE POR EM PERIGO A SEGURANÇA DO TÉCNICO, OPERADOR OU PACIENTE DEVIDO A CHOQUES ELÉTRICOS, MECÂNICOS OU OUTROS. ATENŢIE (RO)  ACEST MANUAL DE SERVICE ESTE DISPONIBIL NUMAI ÎN LIMBA ENGLEZĂ.  DACĂ UN FURNIZOR DE SERVICII PENTRU CLIENŢI NECESITĂ O ALTĂ LIMBĂ DECÂT CEA ENGLEZĂ, ESTE DE DATORIA CLIENTULUI SĂ FURNIZEZE O TRADUCERE.  NU ÎNCERCAŢI SĂ REPARAŢI ECHIPAMENTUL DECÂT ULTERIOR CONSULTĂRII ŞI ÎNŢELEGERII ACESTUI MANUAL DE SERVICE.  IGNORAREA ACESTUI AVERTISMENT AR PUTEA DUCE LA RĂNIREA DEPANATORULUI, OPERATORULUI SAU PACIENTULUI ÎN URMA PERICOLELOR DE ELECTROCUTARE, MECANICE SAU DE ALTĂ NATURĂ. Page 10 Important Precautions  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 ОСТОРОЖНО! (RU) INSTALLATION MANUAL  ДАННОЕ РУКОВОДСТВО ПО ОБСЛУЖИВАНИЮ ПРЕДЛАГАЕТСЯ ТОЛЬКО НА АНГЛИЙСКОМ ЯЗЫКЕ.  ЕСЛИ СЕРВИСНОМУ ПЕРСОНАЛУ КЛИЕНТА НЕОБХОДИМО РУКОВОДСТВО НЕ НА АНГЛИЙСКОМ, А НА КАКОМ-ТО ДРУГОМ ЯЗЫКЕ, КЛИЕНТУ СЛЕДУЕТ САМОСТОЯТЕЛЬНО ОБЕСПЕЧИТЬ ПЕРЕВОД.  ПЕРЕД ОБСЛУЖИВАНИЕМ ОБОРУДОВАНИЯ ОБЯЗАТЕЛЬНО ОБРАТИТЕСЬ К ДАННОМУ РУКОВОДСТВУ И ПОЙМИТЕ ИЗЛОЖЕННЫЕ В НЕМ СВЕДЕНИЯ.  НЕСОБЛЮДЕНИЕ ТРЕБОВАНИЙ ДАННОГО ПРЕДУПРЕЖДЕНИЯ МОЖЕТ ПРИВЕСТИ К ТОМУ, ЧТО СПЕЦИАЛИСТ ПО ОБСЛУЖИВАНИЮ, ОПЕРАТОР ИЛИ ПАЦИЕНТ ПОЛУЧАТ УДАР ЭЛЕКТРИЧЕСКИМ ТОКОМ, МЕХАНИЧЕСКУЮ ТРАВМУ ИЛИ ДРУГОЕ ПОВРЕЖДЕНИЕ. UPOZORNENIE (SK)  TENTO NÁVOD NA OBSLUHU JE K DISPOZÍCII LEN V ANGLIČTINE.  AK ZÁKAZNÍKOV POSKYTOVATEĽ SLUŽIEB VYŽADUJE INÝ JAZYK AKO ANGLIČTINU, POSKYTNUTIE PREKLADATEĽSKÝCH SLUŽIEB JE ZODPOVEDNOSŤOU ZÁKAZNÍKA.  NEPOKÚŠAJTE SA O OBSLUHU ZARIADENIA SKÔR, AKO SI NEPREČÍTATE NÁVOD NA OBLUHU A NEPOROZUMIETE MU.  ZANEDBANIE TOHTO UPOZORNENIA MÔŽE VYÚSTIŤ DO ZRANENIA POSKYTOVATEĽA SLUŽIEB, OBSLUHUJÚCEJ OSOBY ALEBO PACIENTA ELEKTRICKÝM PRÚDOM, DO MECHANICKÉHO ALEBO INÉHO NEBEZPEČENSTVA. ATENCION (ES)  ESTE MANUAL DE SERVICIO SOLO EXISTE EN INGLES.  SI ALGUN PROVEEDOR DE SERVICIOS AJENO A GEMS SOLICITA UN IDIOMA QUE NO SEA EL INGLES, ES RESPONSABILIDAD DEL CLIENTE OFRECER UN SERVICIO DE TRADUCCION.  NO SE DEBERA DAR SERVICIO TECNICO AL EQUIPO, SIN HABER CONSULTADO Y COMPRENDIDO ESTE MANUAL DE SERVICIO.  LA NO OBSERVANCIA DEL PRESENTE AVISO PUEDE DAR LUGAR A QUE EL PROVEEDOR DE SERVICIOS, EL OPERADOR O EL PACIENTE SUFRAN LESIONES PROVOCADAS POR CAUSAS ELÉCTRICAS, MECÁNICAS O DE OTRA NATURALEZA. Important Precautions Page 11  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 VARNING INSTALLATION MANUAL  DEN HÄR SERVICEHANDBOKEN FINNS BARA TILLGÄNGLIG PÅ ENGELSKA.  OM EN KUNDS SERVICETEKNIKER HAR BEHOV AV ETT ANNAT SPRÅK ÄN ENGELSKA ANSVARAR KUNDEN FÖR ATT TILLHANDAHÅLLA ÖVERSÄTTNINGSTJÄNSTER. (SV)  FÖRSÖK INTE UTFÖRA SERVICE PÅ UTRUSTNINGEN OM DU INTE HAR LÄST OCH FÖRSTÅR DEN HÄR SERVICEHANDBOKEN.  OM DU INTE TAR HÄNSYN TILL DEN HÄR VARNINGEN KAN DET RESULTERA I SKADOR PÅ SERVICETEKNIKERN, OPERATÖREN ELLER PATIENTEN TILL FÖLJD AV ELEKTRISKA STÖTAR, MEKANISKA FAROR ELLER ANDRA FAROR. DİKKAT (TR)  BU SERVİS KILAVUZUNUN SADECE İNGİLİZCESİ MEVCUTTUR.  EĞER MÜŞTERİ TEKNİSYENİ BU KILAVUZU İNGİLİZCE DIŞINDA BİR BAŞKA LİSANDAN TALEP EDERSE, BUNU TERCÜME ETTİRMEK MÜŞTERİYE DÜŞER.  SERVİS KILAVUZUNU OKUYUP ANLAMADAN EKİPMANLARA MÜDAHALE ETMEYİNİZ.  BU UYARIYA UYULMAMASI, ELEKTRİK, MEKANİK VEYA DİĞER TEHLİKELERDEN DOLAYI TEKNİSYEN, OPERATÖR VEYA HASTANIN YARALANMASINA YOL AÇABİLİR. DAMAGE IN TRANSPORTATION All packages should be closely examined at time of delivery. If damage is apparent write “Damage In Shipment” on ALL copies of the freight or express bill BEFORE delivery is accepted or “signed for” by a GE representative or hospital receiving agent. Whether noted or concealed, damage MUST be reported to the carrier immediately upon discovery, or in any event, within 14 days after receipt, and the contents and containers held for inspection by the carrier. A transportation company will not pay a claim for damage if an inspection is not requested within this 14 day period. Call GEHC Global Parts 1-800-548-3366 and select option 8, immediately after damage is found. At this time be ready to supply name of carrier, delivery date, consignee name, freight or express bill number, item damaged and extent of damage. Complete instructions regarding claim procedure are found in Section S of the Policy And Procedures Bulletins. 14 July 1993 CERTIFIED ELECTRICAL CONTRACTOR STATEMENT All electrical Installations that are preliminary to positioning of the equipment at the site prepared for the equipment shall be performed by licensed electrical contractors. In addition, electrical feeds into the Power Distribution Unit shall be performed by licensed electrical contractors. Other connections between pieces of electrical equipment, calibrations and testing shall be performed by qualified GE Healthcare personnel. The products involved (and the accompanying electrical installations) are highly sophisticated, and special engineering competence is required. In performing all electrical work on these products, GE will use its own specially trained field engineers. All of GE’s electrical work on these products will comply with the requirements of the applicable electrical codes. Page 12 Important Precautions  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL The purchaser of GE equipment shall only utilize qualified personnel (i.e., GE’s field engineers, personnel of third-party service companies with equivalent training, or licensed electricians) to perform electrical servicing on the equipment. IMPORTANT...X-RAY PROTECTION X-ray equipment, if not properly used, may cause injury. Accordingly, the instructions herein contained should be thoroughly read and understood by everyone who will use the equipment before you attempt to place this equipment in operation. The General Electric Company, Healthcare Group, will be glad to assist and cooperate in placing this equipment in use. Although this apparatus incorporates a high degree of protection against x-radiation other than the useful beam, no practical design of equipment can provide complete protection. Nor can any practical design compel the operator to take adequate precautions to prevent the possibility of any persons carelessly exposing themselves or others to radiation. It is important that anyone having anything to do with x-radiation be properly trained and fully acquainted with the recommendations of the National Council on Radiation Protection and Measurements as published in NCRP Reports available from NCRP Publications, 7910 Woodmont Avenue, Room 1016, Bethesda, Maryland 20814, and of the International Commission on Radiation Protection, and of any other local authorities, and take adequate steps to protect against injury. The equipment is sold with the understanding that the General Electric Company, Healthcare Group, its agents, and representatives have no responsibility for injury or damage which may result from improper use of the equipment. Various protective materials and devices are available. It is urged that such materials or devices be used. LITHIUM BATTERY CAUTIONARY STATEMENTS CAUTION Risk of Explosion Danger of explosion if battery is incorrectly replaced. Replace only with the same or equivalent type recommended by the manufacturer. Discard used batteries according to the manufacturer’s instructions. OMISSIONS & ERRORS Customers, please contact your GE Sales or Service representatives. GE personnel, please use the GEHC CQA Process to report all omissions, errors, and defects in this publication. Important Precautions Page 13  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL This page is intentionally left blank. Page 14 Important Precautions  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Revision History Revision Date Reason for change 1 Mar.9, 2015 First Release 2 Apr.27.2015 Add the instruction to paste IECV3 label in fields 3 May.22.2015 Add tube and generator specification in Chapter 1. Add more instruction about multi-language labels pasted in Fields by Field engineers in Chapter 9. 4 5 Mar.5,2016 Remove the Korean label paste instruction by regulatory requirement. Aug.19th.2016 Update collimator installation process. Update the monitor part number and calibration process. 6 Remove Login password. Mar.17th.2017 Add HP Z440 PC FRU part and its low level FRU parts in the Chapter13. Update OS and APP software data backup/restore steps in Chapter 11. Add monitor calibration procedures for HPZ440 PC. Add software troubleshooting solution for HPZ440 PC in Chapter 15. Update the IF board part number. 7 Sep.12th.2017 Update some Diagnostics and Troubleshooting content in Chapter 15. Update some FRU numbers in Chapter 13. Revision History Page 15 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 16  INSTALLATION MANUAL  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Preface Publication Conventions INSTALLATION MANUAL Standardized conventions for representing information is a uniform way of communicating information to a reader in a consistent manner. Conventions are used so that the reader can easily recognize the actions or decisions that must be made. There are a number of character and paragraph styles used in this publication to accomplish this task. Please become familiar with them before proceeding forward. It’s important that you read and understand hazard statements, and not just ignore them. Section 1.0 Safety & Hazard Information Proper product safety labeling allows a person to safely use or service a product. The format and style for safety communications reflected in this publication represents the harmonization of IEC/ ISO 3864 and ANSI Z535 standards. Within this publication, different paragraph and character styles are used to indicated potential hazards. Paragraph prefixes, such as hazard, caution, danger and warning, are used to identify important safety information. Text (Hazard) styles are applied to the paragraph contents that are applicable to each specific safety statement. 1.1 Hazard Messages Any action that will, could or potentially cause personal injury will be preceded by the safety alert symbol and an appropriate signal word. The safety alert symbol is the triangle with an exclamation mark within it. It’s always used next to the signal word to indicate the severity of the hazard. Together, they are used to indicate a hazard exists. Signal words describe the severity of possible human injures that may be encountered. The alert symbol and signal word are placed immediately before any paragraph they affect. Safety information includes: 1.) Signal Word - The seriousness level of the hazard. 2.) Symbol or Pictorial - The consequence of interaction with the hazard. 3.) Word Message: a.) The nature of the hazard (i.e. the type of hazard) b.) How to avoid the hazard. The safety alert symbol is not used when an action can only cause equipment damage. 1.2 Text Format of Signal Words DANGER - INDICATES AN IMMINENTLY HAZARDOUS SITUATION WHICH, IF NOT AVOIDED, WILL RESULT IN DEATH OR SERIOUS INJURY. THIS SIGNAL WORD IS LIMITED TO THE MOST EXTREME SITUATIONS. WARNING - INDICATES A POTENTIALLY HAZARDOUS SITUATION WHICH, IF NOT AVOIDED, COULD RESULT IN DEATH OR SERIOUS INJURY. Caution - Indicates a potentially hazardous situation which, if not avoided, may result in minor or moderate injury. It may also be used to alert against unsafe practices. Preface Page 17  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL NOTICE - Indicates information or a company policy that relates directly or indirectly to the safety of personnel or protection of property. This signal word is associated directly with a hazard or hazardous situation and is used in place of 'DANGER,' 'WARNING,' or 'CAUTION.' It can include: 1.3 • Destruction of a disk drive • Potential for internal mechanical damage, such as to a X-ray tube Symbols and Pictorials Used The following Symbols and Pictorials are be used in this publication. These graphical icons (symbols) may be used to make you aware of specific types of hazards that could possibly cause harm. Page 18 keep_up magnetic biohazard compressgas ppe-hearing fragile impact corrosive heavyobject ppe-2people static_elec heat general laser ppe-respitory keep_dry pinch radiation poisongas ppe-loto general explosive electrical flammable ppe-eye torque crush/mechanical tipping Read Manual ppe-gloves ce instuction poisonmatl entanglement instuction Preface  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Symbols This section explains the symbols used on this system and in its accompanying documents. Special Notices Table 0-1 Special notices Symbol Description Dangerous voltage. This indicates an avoidable, dangerous, high voltage hazard. This symbol on the equipment indicates the operating instructions should be consulted to assure safe operation. This symbol indicates that waste electrical and electronic equipment must not be disposed of as unsorted municipal waste and must be collected separately. Please contact an authorized representative of the manufacturer for information concerning the decommissioning of your equipment. Follow instructions for use X-ray Tube Table 0-2 describes the operational symbols for the system such as X-ray emissions and collimator locations. Table 0-2Operational symbols Symbol Description X-ray emission is used to indicate the X-ray tube head is emitting X-rays. Take adequate precautions to prevent the possibility of any persons carelessly, unwisely, or unknowingly exposing themselves or others to radiation. X-ray source assembly is used to indicate a reference to an Xray source assembly. Preface Page 19  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Symbol Description Identifies controls or indicators associated with the selection of a small focal spot or the connection for the corresponding filament. Identifies controls or indicators associated with the selection of a large focal spot or the connection for the corresponding filament. Power ON and OFF Symbol Description A gray SYSTEM RESET button is used to reset the system. The button is located on the console. A gray POWER ON button is used to turn on the power to the system. The button is located on the console. Electrical Type Table 0-3 describes the electrical protection rating based on system type. Table 0-3Electrical type Symbol Description Type B Equipment indicates the equipment provides a particular degree of protection against electrical shock regarding leakage current and protective earthing per IEC60601-1. Electrical Current Table 0-4describes the symbols for the different types of electrical current that may be used on your system. Page 20 Preface  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Table 0-4 Electrical current types Symbol Description Alternating Current indicates the equipment is suitable for alternating current only. Direct Current indicates the equipment is suitable for direct current only. Both direct and alternating currents indicate the equipment is suitable for both direct and alternating current. Ground Table 0-5describes the different types of grounding used in your system. Table 0-5 Ground types Symbol Description Functional Earth (ground) Terminal indicates a terminal directly connected to a point of a measuring supply or control circuit or to a screening part , which is intended to be earthed for functional purposes. Protective earth (ground) identifies any terminal which is intended for connection of an external protective conductor to protect against electrical shock in case of a fault. Frame or chassis identify the frame or chassis terminal. Collimator Table 0-6describes the collimator controls and the radiation field. Table 0-6 Collimator descriptions Symbol Description Control for indicating radiation field by using light. Preface Page 21  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Symbol Description Indicates the collimator blades are closed. The controlled blades are shown in thicker lines. Indicates the collimator blades are open. The controlled blades are shown in thicker lines. Equipment Classifications The following equipment classifications are applicable to the product: • Equipment classification with respect to protection from electric shock: Class I • Degree of protection from electric shock: Type B • Degree of protection against ingress of liquids: IPX0 • Equipment not suitable for use in the presence of a flammable anesthetic mixture with air or with nitrous oxide • Mode of operation: Continuous operation with intermittent loading Section 1.0 Publication Conventions 1.1 General Paragraph and Character Styles Prefixes are used to highlight important non-safety related information. Paragraph prefixes (such as Purpose, Example, Comment or Note) are used to identify important but non-safety related information. Text styles are also applied to text within each paragraph modified by the specific prefix. EXAMPLES OF PREFIXES USED FOR GENERAL INFORMATION: Purpose: Introduces and provides meaning as to the information contained within the chapter, section or subsection (such as used at the beginning this chapter, for example). Note: Example: Comment: Page 22 Conveys information that should be considered important to the reader. Used to make the reader aware that the paragraph(s) that follow are examples of information possibly stated previously. Represents “additional” information that may or may not be relevant to your situation. Preface  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2 INSTALLATION MANUAL Page Layout Publication Part Number & Revision Number The current section and its title are always shown in the footer of the left (even) page. An exclamation point in a triangle is used to indicate important information to the user. Paragraphs preceeded by Alphanumeric characters (e.g. numbers) contain information that must be followed in a specific order. Publication Title The current chapter and its title are always shown in the footer of the right (odd) page. Paragraphs preceeded by a symbol (e.g. bullets) contain information that has no specific order. Headers and footers in this publication are designed to allow you to quickly identify your location. The document part number and revision number appears in every header on every page. Odd numbered page footers indicate the current chapter, its title and current page number. Even page footers show the current section and its title, as well as the current page number. 1.3 Computer Screen Output/Input Text Character Styles Within this publication, mono-spaced character styles (fonts) are used to indicate computer text that’s either screen input and output. Mono-spaced fonts, such courier, are used to indicated text direction. When you type at your keyboard, you are generating computer input. Occasionally you will see the math operator “greater-than” and “less-than” symbols used to indicate the start and finish of variable output. When reading text generated by the computer, you are reading it as computer generated output. In addition to direction, characters are italicized (e.g. italics) to indicate information specific to your system or site. Example: Fixed Output This paragraph’s font represents computer generated screen “fixed” output. Its output is fixed from the sense that it does not vary from application to application. It’s the most commonly used style used to indicate filenames, paths and text that do not change from system to system. The character style used is a fixed width such as courier. Example: Variable Output This paragraph’s font represents computer screen output that is “variable”. It’s used to represent output that varies from application to application or system to system. Variable output is sometimes found placed between greater-than and less-than operators for clarification. For example: or . In both cases, the < and > operators are not part of the actual input. Preface Page 23  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Example: Fixed Input This paragraph’s font represents fixed input. It’s computer input that is typed-in via the keyboard. Typed input that does not vary from application to application or system to system. Fixed text the user is required to supply as input. For example: cd /usr/3p Example: Variable Input This paragraph’s font represents computer input that can vary from application to application or system to system. With variable text, the user is required to supply system dependent input or information. Variable input sometimes is placed between greater-than and less-than operators. For example: . In these cases, the () operators would be dropped prior to input. For example: ypcat hosts | grep would be typed into the computer as: ypcat hosts | grep 3.45.120.3 without the greater-than and less-than operators. 1.4 Buttons, Switches and Keyboard Inputs (Hard & Soft Keys) Different character styles are used to indicate actions requiring the reader to press either a hard or soft button, switch or key. Physical hardware, such as buttons and switches, are called hard keys because they are hard wired or mechanical in nature. A keyboard or on/off switch would be a hard key. Software or computer generated buttons are called soft keys because they are software generated. Software driven menu buttons are an example of such keys. Soft and hard keys are represented differently in this publication. Example: Hard Keys A power switch ON/OFF or a keyboard key like ENTER is indicated by applying a character style that uses both over and under-lined bold text that is bold. This is a hard key. Example: Soft Keys Whereas the computer MENU button that you would click with your mouse or touch with your hand uses over and under-lined regular text. This is a soft key. Page 24 Preface  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Table of Contents Preface Publication Conventions ...................................................................................... 17 Section 1.0 Safety & Hazard Information ........................................................................... 17 1.1 1.2 1.3 Hazard Messages............................................................................................................ 17 Text Format of Signal Words ........................................................................................... 17 Symbols and Pictorials Used ........................................................................................... 18 Section 1.0 Publication Conventions ................................................................................. 22 1.1 1.2 1.3 1.4 General Paragraph and Character Styles........................................................................ Page Layout..................................................................................................................... Computer Screen Output/Input Text Character Styles .................................................... Buttons, Switches and Keyboard Inputs (Hard & Soft Keys) ........................................... 22 23 23 24 Chapter 1 - Before you Begin ............................................................................... 33 Section 1.0 Lock-Out & Tag-Out (LOTO)............................................................................ 33 1.1 1.2 System Power.................................................................................................................. 33 LOTO Procedure for System Power ................................................................................ 34 Section 2.0 System Preparation for Energizing Power................................. 35 Section 3.0 Energizing System ....................................................................... 35 Section 4.0 De-Energizing System ................................................................. 36 Section 5.0  Equipment Safety - Electrostatic Discharge (ESD) ....................................... 36 5.1 5.2 5.3 5.4 Generating Static ............................................................................................................. Personal Grounding Methods and Equipment................................................................. Grounding the Work Area ................................................................................................ Recommended Materials and Equipment........................................................................ 36 37 37 38 Section 6.0 Important...X-Ray Protection ...................................................... 38 Section 7.0 Damage in Transportation........................................................... 39 Section 8.0 Certified Electrical Contractor Statement .................................. 39 Section 9.0 Omissions and Errors.................................................................. 39 Section 10.0 Package and Service Toolket.................................................... 39 Section 11.0 Tube and Generator Specifications.......................................... 41 11.1 11.2 Tube Specifications ......................................................................................................... 41 Generator Specifications ................................................................................................. 41 Table of Contents Page 25  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Chapter 2 System Architect and Component .................................................... 43 Chapter 3 - System Installation Guide and Checklist ....................................... 45 Section 1.0 Installation......................................................................................................... 45 Section 2.0 Installation Checklist.................................................................... 47 Chapter 4 Service Tool Instruction ..................................................................... 49 Section 1.0 Component.................................................................................... 49 Section 2.0 Installation..................................................................................... 50 Section 3.0 Planned Maintenance ................................................................... 50 3.1 3.2 3.3 3.4 3.5 Foldable crane maintenance:.......................................................................................... Transporting dolly maintenance ...................................................................................... Rotating shaft and shaft hole maintenance..................................................................... Lifting belt maintenance .................................................................................................. Overall transport considerations ..................................................................................... 50 51 51 51 51 Chapter 5 - System Hardware Installation .......................................................... 53 Section 1.0 U-Arm Positioning ............................................................................................ 53 Section 2.0 Detector Housing Component..................................................... 69 2.1 2.2 2.3 Unpacking ....................................................................................................................... 69 Installation ....................................................................................................................... 69 Cable connection ............................................................................................................ 74 Section 3.0 X-ray Tube and Collimator ............................................................................... 82 3.1 3.2 3.3 Unpacking ....................................................................................................................... 82 Installation ....................................................................................................................... 83 Cable connection ............................................................................................................ 89 Section 4.0 Cable Connection to Top box .................................................... 97 Section 5.0 Cabinet Electrical Connections ...................................................................... 99 Section 6.0 - Workstation and Console Installation ................................... 104 6.1 6.2 6.3 6.4 6.5 6.6 Page 26 Computer ...................................................................................................................... Mouse and Keyboard .................................................................................................... Console & Handswitch .................................................................................................. LCD Monitor .................................................................................................................. Bar Code Reader (Purchased Option) .......................................................................... Workstation Cable Connections.................................................................................... Table of Contents 104 104 104 105 105 106  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Section 7.0 System Cable Connection ......................................................... 106 Section 8.0 Cover Installation ....................................................................... 106 Section 9.0 Table Assembly ......................................................................... 109 Section 10.0 Power On and Positioner Check............................................. 110 10.1 10.2 10.3 Alignment....................................................................................................................... 10.1.1 Image chain alignment check. .......................................................................... 10.1.2 Image chain alignment procedure .................................................................... Couterweight.................................................................................................................. Installation Checklist ...................................................................................................... 110 110 111 118 119 Chapter 6 System Configuration....................................................................... 123 Section 1.0 When to Perform System Configuration .................................. 123 1.1 1.2 1.3 During System Installation ............................................................................................. 123 Missing or Lost System Backups................................................................................... 123 Addition of Purchased Options ...................................................................................... 123 Section 2.0 Starting the System Configuration Tool .................................. 124 Section 3.0 System Configuration Tool Parameters................................... 124 3.1 3.2 3.3 3.4 3.5 3.6 Site Parameters ............................................................................................................. General Parameters ...................................................................................................... Positioner....................................................................................................................... Product Network Filters ................................................................................................. HIPAA Configuration...................................................................................................... Generator Time.............................................................................................................. 124 125 126 126 127 127 Section 4.0 Network Connection (DICOM) Configuration .......................... 127 4.1 4.2 4.3 Network Hosts ............................................................................................................... 4.1.1 Host Tab ........................................................................................................... 4.1.2 Preference Tab ................................................................................................. Printers .......................................................................................................................... 4.2.1 Agfa Drystar 3000 Printer ................................................................................ 4.2.2 Agfa Drystar 5500............................................................................................. 4.2.3 Fuji FM DPL Print Parameters.......................................................................... 4.2.4 Fuji DryPix 1000 Print Parameters ................................................................... 4.2.5 Fuji DryPix 3000 Print Parameters ................................................................... 4.2.6 Fuji DryPix 7000 Printer Parameters ................................................................ 4.2.7 Kodak 8200 Print Parameters........................................................................... 4.2.8 Kodak 8500 Print Parameters........................................................................... 4.2.9 Kodak 8700 Print Parameters........................................................................... 4.2.10 Kodak 8900 Print Parameters........................................................................... 4.2.11 Codonics Horizon Print Parameters ................................................................. Query Modality............................................................................................................... 127 127 128 129 129 131 134 135 137 139 140 142 143 145 146 148 Section 5.0 Install Demo Images................................................................... 148 Section 6.0 Operator’s Manual (OM) Installation......................................... 148 Section 7.0 Jedi Time Sync with System Time............................................ 149 Section 8.0 Adding a Bar Code Reader........................................................ 150 8.1 Configuration ................................................................................................................. 150 Table of Contents Page 27  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Section 9.0 System Login (HIPPA)................................................................ 150 9.1 9.2 9.3 User Accounts.............................................................................................................. 9.1.1 System Log-in .................................................................................................. 9.1.2 About User Accounts ....................................................................................... 9.1.3 Default User Accounts ..................................................................................... Login Feature ................................................................................................................ 9.2.1 Logging In and Out........................................................................................... 9.2.2 Understanding users and groups ..................................................................... 9.2.3 Understanding groups and privileges............................................................... Configuring the System................................................................................................. 150 150 150 151 151 151 151 151 152 Section 10.0 iLinq user guide ....................................................................... 152 Chapter 7System Installation Calibration ......................................................... 153 Section 1.0 Before You Begin....................................................................... 153 1.1 1.2 1.3 1.4 1.5 Service User Interface (SUIF) ....................................................................................... 153 Calibration Sequence.................................................................................................... 153 1.2.1 After first installation, those calibrations are needed. Follow the steps below in. ... 154 1.2.2 Saving Changes ............................................................................................... 154 1.2.3 Invoking New Calibrations................................................................................ 154 Returning the System to the User ................................................................................. 154 Temporarily Changing the Measurement System to Calibrations ................................. 155 The use of Collimator(XS-1D) tape (Note the difference between SID and OID) ......... 155 Section 2.0 Positioner .................................................................................... 155 Section 3.0 Tube Warm-up for Accuracy...................................................... 155 3.1 3.2 3.3 REQUIREMENTS ......................................................................................................... 155 Before you begin ........................................................................................................... 156 Tube Warm-up Procedure for Accuracy........................................................................ 156 Section 4.0 AEC Calibration.......................................................................... 157 4.1 4.2 Before You Begin .......................................................................................................... Table Ion Chamber ....................................................................................................... 4.2.1 Before You Begin ............................................................................................. 4.2.2 Procedure......................................................................................................... 157 157 157 157 Section 5.0 Detector (Bad Pixels, Gain, CF) Calibration ............................ 158 5.1 5.2 5.3 5.4 Before You Begin .......................................................................................................... Calibration Overview ..................................................................................................... When should it be performed ........................................................................................ Procedure...................................................................................................................... 158 158 159 159 Section 6.0 Dose Predication - mR/mAs...................................................... 160 Section 7.0 Image Quality Calibration........................................................ 160 Section 8.0 Generator Accuracy Test Calibration ...................................... 160 Section 9.0 Monitor Calibration .................................................................... 160 Section 10.0 PACS / Image Display Test Image .......................................... 162 10.1 10.2 Page 28 Objectives ..................................................................................................................... 162 Simplified Procedure ..................................................................................................... 162 Table of Contents  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 10.3 INSTALLATION MANUAL Results........................................................................................................................... 164 Section 11.0 Quality Assurance Procedure (QAP) ..................................... 165 11.1 11.2 11.3 Before You Begin........................................................................................................... 165 When to Perform QAP ................................................................................................... 165 Simplified Procedures.................................................................................................... 165 Chapter 8System Check ..................................................................................... 167 Section 1.0 Operational Checks.................................................................... 167 1.1 1.2 1.3 1.4 1.5 1.6 U-Arm Longitudinal Movement ...................................................................................... Positioner SID Adjustment............................................................................................. Tube Rotation ................................................................................................................ Detector Housing Rotation............................................................................................. Collimator Rotation ........................................................................................................ Grid Insert ...................................................................................................................... 167 167 167 167 167 167 Section 2.0 Functional Checks ..................................................................... 168 2.1 2.2 2.3 Image quality test........................................................................................................... 168 Image artifact check (Optional)...................................................................................... 168 Acqisition Test ............................................................................................................... 168 Chapter 9 - Labels and Rating Plates ................................................................ 169 Section 1.0 Labels to Attach in Field ........................................................... 169 Section 2.0 Rating Plate................................................................................ 171 Chapter 10Final Admin Job ................................................................................ 175 Chapter 11 Software Instruction ....................................................................... 177 Section 1.0System Data Backup and Restore ............................................. 177 1.1 1.2 1.3 System Backup’s Coverage.......................................................................................... Backup.......................................................................................................................... 1.2.1 Before You Begin.............................................................................................. 1.2.2 Procedure ......................................................................................................... Restore ......................................................................................................................... 1.3.1 Before You Begin.............................................................................................. 1.3.2 Procedure ......................................................................................................... 177 178 178 178 179 179 180 Section 2.0 System Software Load and/or Upgrade ................................... 182 2.1 2.2 2.3 2.4 2.5 Personnel Requirements .............................................................................................. Overview....................................................................................................................... Preliminary Requirements ............................................................................................ 2.3.1 Tools and Test Equipment................................................................................ 2.3.2 Consumables.................................................................................................... 2.3.3 Safety................................................................................................................ 2.3.4 Required Conditions ......................................................................................... Procedure ..................................................................................................................... Finalization.................................................................................................................... Table of Contents 182 182 183 183 183 183 183 183 197 Page 29  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Section 3.0Jedi Service Tool ......................................................................... 197 3.1 Service Software User Guide....................................................................................... 3.1.1 Supplies ........................................................................................................... 3.1.2 Tools ................................................................................................................ 3.1.3 Safety Precautions ........................................................................................... 3.1.4 Prerequisites .................................................................................................... 3.1.5 Personnel ......................................................................................................... 3.1.6 Time ................................................................................................................. 3.1.7 Procedure......................................................................................................... 197 197 197 197 198 198 198 198 Section 4.0Service Tool Job Cards............................................................... 204 4.1 4.2 4.3 Software Download / Upgrade ...................................................................................... 4.1.1 Supplies ........................................................................................................... 4.1.2 Tools ................................................................................................................ 4.1.3 Safety Precautions ........................................................................................... 4.1.4 Prerequisites .................................................................................................... 4.1.5 Personnel ......................................................................................................... 4.1.6 Time ................................................................................................................. 4.1.7 Procedure......................................................................................................... Tube Replacement Software Procedure ...................................................................... 4.2.1 Supplies ........................................................................................................... 4.2.2 Tools ................................................................................................................ 4.2.3 Safety Precautions ........................................................................................... 4.2.4 Prerequisites .................................................................................................... 4.2.5 Personnel ......................................................................................................... 4.2.6 Time ................................................................................................................. 4.2.7 Procedure......................................................................................................... Exposure mode while opening the jedi service tool ...................................................... 204 204 205 205 205 205 205 205 206 206 207 207 207 207 207 207 211 Chapter 12 Regulatory Test Procedure............................................................. 215 Section 1.0 Electrical Safety Equipment Grounding ................................... 215 Section 2.0 Electrical Safety Leakage Current............................................. 215 Chapter 13 Illustrated Renewal Parts................................................................ 217 Section 1.0 Illustrated Renewal parts .......................................................... 217 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Page 30 Service Tool .................................................................................................................. Table ............................................................................................................................. Image Chain.................................................................................................................. Control Room ................................................................................................................ PDU............................................................................................................................... MIS Cable ..................................................................................................................... U-Arm............................................................................................................................ JEDI Generator Renewal Parts..................................................................................... 1.8.1 Introduction ...................................................................................................... 1.8.2 JEDI Generator Renewal Parts List ................................................................. 1.8.3 FRU Information ............................................................................................... 1.8.4 Jedi 50 R 1T Structure ..................................................................................... 1.8.5 Renewal Parts .................................................................................................. 1.8.6 Cables .............................................................................................................. Table of Contents 217 217 218 219 221 222 222 230 230 230 231 233 234 237  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.9 INSTALLATION MANUAL JEDI Generator Disassembly/Reassembly.................................................................... 1.9.1 Introduction ....................................................................................................... 1.9.2 Tools ................................................................................................................. 1.9.3 HV Tank, 1 Tube, 1-3 Phase ............................................................................ 1.9.4 Inverter Mid-Power Assembly........................................................................... 1.9.5 I/F Board RAD .................................................................................................. 1.9.6 KV Board RAD.................................................................................................. 1.9.7 EMC Board 3 Phases ....................................................................................... 1.9.8 AC/DC 3 PH Mid Power Assembly ................................................................... 1.9.9 Inverter Coil Mid Power Assembly.................................................................... 1.9.10 Capacitor Inverter Assembly............................................................................. 1.9.11 LV Power Supply 3 Phase Board ..................................................................... 1.9.12 Filament Board 1 INV ....................................................................................... 1.9.13 Rotor Board High Speed................................................................................... 1.9.14 AEC Board........................................................................................................ 238 238 238 239 243 252 254 256 259 262 265 270 273 276 279 Section 2.0 Part Replacement ....................................................................... 282 2.1 2.2 2.3 2.4 2.5 2.6 2.7 2.8 2.9 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 Detector replacement .................................................................................................... Grid-in Switch in Detector Housing................................................................................ Grid Detent Replacement .............................................................................................. X-Ray Tube/Collimator replacement.............................................................................. Relay on Topbox Replacement ..................................................................................... Detector Power Supply Replacement............................................................................ 150w Power Supply ....................................................................................................... Configured Servo........................................................................................................... Motor Component on Column Replacement ................................................................. Console LCD on Tube Support Replacement ............................................................... Angle LCD Replacement ............................................................................................... Spine PCB board Replacement(5430961) .................................................................... Spring on Tube Support Replacement .......................................................................... PDU Unit Replacement.................................................................................................. Collimator Lamp (5136302) Replacement ..................................................................... Spring of U-Arm Rotation Detent Replacement............................................................. SID Brake Replacement(5447915/5491345)................................................................. Brake on Column Top Replacement (5453213) ............................................................ Brake in Angle Meter Replacement (5452377).............................................................. Steel Rope, safelock and spring Replacement.............................................................. DAP meter replacement ................................................................................................ 282 283 284 285 286 286 287 288 289 289 290 291 291 292 293 294 295 296 296 298 301 Chapter 14 Integrating the Healthcare Enterprise (IHE) Integration Statement ... 303 Section 1.0 - Introduction .............................................................................. 303 1.1 1.2 Overview........................................................................................................................ 303 Important Remarks ....................................................................................................... 303 Section 2.0 - IHE Integration Statement ....................................................... 304 Chapter 15 Diagnostic and Troubleshooting...................................................... 305 Section 1.0 Troubleshooting ......................................................................... 305 1.1 Using the Enhanced Error Messages ........................................................................... 305 Table of Contents Page 31  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 1.10 1.11 1.12 1.13 INSTALLATION MANUAL Workstation ................................................................................................................. 1.2.1 Bar Code Reader ............................................................................................. 1.2.2 Console ............................................................................................................ 1.2.3 LCD Monitor ..................................................................................................... Soft Reset of Software on PC ...................................................................................... Engineering Toolkit ...................................................................................................... QAP Results and Images ............................................................................................ Software Toubleshooting .............................................................................................. Software Issue .............................................................................................................. PDU Troubleshooting.................................................................................................... Electrical Subsystem Troubleshooting ......................................................................... Image Quality Troubleshooting ..................................................................................... Dicom Network Troubleshooting ................................................................................... L/R Shifting Issue .......................................................................................................... Image Print Issue .......................................................................................................... 305 305 306 306 307 308 309 311 316 319 321 322 323 323 324 Section 2.0 Console LCD Service function .................................................. 324 2.1 2.2 2.3 2.4 Login Service Tab ......................................................................................................... Positioner Calibration .................................................................................................... Hardware Faults Diagnostic .......................................................................................... 2.3.1 Manual Diagnostic............................................................................................ 2.3.2 Automatic Diagnostic ....................................................................................... Hardware Configuration ................................................................................................ 324 324 325 325 326 326 Chapter 16 - Schematics and Drawings ............................................................ 327 Section 1.0 System Schematics .................................................................... 327 Section 2.0 System Electric Assembly ......................................................... 328 Section 3.0 Cable Assembly .......................................................................... 329 Section 4.0 Console Circuit .......................................................................... 331 Section 5.0 PDU Electric Board..................................................................... 332 Section 6.0 Spine Board................................................................................ 334 Section 7.0 IF Board ....................................................................................... 336 Chapter 17Planning Maintenance...................................................................... 345 Section 1.0Planning Maintenance................................................................. 345 Section 2.0 Planning Maitenance Report ..................................................... 346 Page 32 Table of Contents  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Chapter 1 - Before you Begin Section 1.0 Lock-Out & Tag-Out (LOTO) 1.1 System Power Name Of Equipment: System (Workstation, System Cabinet, Table, U-Arm) Number Of Locks: One per person, working on the system Title(s) of Employees Authorized to Perform LOTO: Those trained in Lockout Tagout (LOTO) Title(s) of Affected Employees and How to Notify: Hospital Personnel; notified by verbal communication. Energy Source Yes Electrical No X Pneumatic Hydraulic Gas/Water/Steam Chemical Mechanical Motion Gravity Springs Thermal Stored Energy Air Under Pressure Oil Under Pressure Water Under Pressure Gas Under Pressure Steam Other Location of Energy Isolating Magnitude of Energy Means System’s Main “A1” Power 320 - 480VAC, 3 Phase Disconnect X X X X X X X X X X X X X X X Type(s) of Equipment and/or Method(s) Selected to Dissipate or Isolate Stored Energy: Allow 3 minutes for stored energy to dissipate. Type(s) of Equipment and/or Method(s) Used to Ensure Disconnection’s: One Lock & Tag for Main “A1” Disconnect Chapter 1 - - Before you Begin Page 33 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2  INSTALLATION MANUAL LOTO Procedure for System Power Name of Equipment: System (Workstation, System Cabinet, Table, U-Arm) Step Lockout/Tagout Procedure Page 34 1 Prepare for shutdown of equipment by notifying affected personnel working in the area that lockout/tagout is being performed. 2 Bring system software down. See Section 4.0 on page 36 and return to Step 3 3 Locate main power supply (Service) disconnect feeding System Cabinet. 4 Lock Out / Tag Out the main power disconnect. 5 Using an insulated voltmeter, measure the incoming power connection to the system cabinet at the circuit breaker. 6 If no voltage is present at the system cabinet’s circuit breaker; place the power switch on the PDU to the OFF position and service equipment as required. 7 After service has been performed, notify affected personnel that equipment will be reenergized and LOTO devices are being removed. 8 Assure the safety of the area and that all safety devices and guards have been replaced 9 Return system functions to a preset state. 10 Remove Lock-Out Tag-Out equipment from main disconnect. 11 Locate main power supply (Service) disconnect feeding System Cabinet and re-apply power. 12 Perform system startup. See Energizing System on page 35. Section 1.0 - Lock-Out & Tag-Out (LOTO)  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Section 2.0 System Preparation for Energizing Power POTENTIAL ELECTRICAL SHOCK PERFORM LOTO BEFORE PERFORMING SERVICE OF ANY KIND. See Section 1.0 on page 33. Follow the steps below to ensure that your system powers up safely, properly and reliably. Potential for Equipment Damage PDU tap settings must match input voltage else there is potential for equipment damage. Section 3.0 Energizing System System power-up is controlled by both hardware and software. When power is applied, power is switched “ON” to each of the subsystems through hardware. Software in the subsystems boot and begin loading their operating systems and applications. Complete system startup takes approximately 2 minutes. 1.) Prepare the system for energizing, if required. See System Preparation for Energizing Power on page 35. 2.) Remove tag and lock from facility power. See Section 1.2 on page 34 3.) Press the POWER ON button on the console to initiate system start-up. Figure 1-1 Console Power On Button 4.) System startup is complete when applications screen is displayed on workstation computer. Chapter 1 - - Before you Begin Page 35 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Section 4.0 De-Energizing System Shut down is controlled by both software and hardware. When a shutdown is initiated, application and the operating software execution is terminated. While this takes place, signals are sent to the PDU to shut-off system hardware. Complete shutdown takes approximately 1 minute. 1.) From the application interface, using the mouse, click on the tools icon. This selects the Service User Interface. 2.) Now click on SHUT DOWN. 3.) Now tag and lock out facility power to the system, if you wish to perform service. See Section 1.2 on page 34. Section 5.0 Equipment Safety - Electrostatic Discharge (ESD) A sudden discharge of static electricity from your finger or other conductor can destroy staticsensitive devices or microcircuitry. Often the spark is neither felt nor heard, but damage occurs. An electronic device exposed to electrostatic discharge (ESD) might not appear to be affected at all and can work perfectly throughout a normal cycle. The device can function normally for a while, but it has been degraded in the internal layers, reducing its life expectancy. Networks built into many integrated circuits provide some protection, but in many cases, the discharge contains enough power to alter device parameters or melt silicon junctions. 5.1 Generating Static The following table shows that: • Page 36 Different activities generate different amounts of static electricity. Section 4.0 - De-Energizing System  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • INSTALLATION MANUAL Static electricity increases as humidity decreases. Relative Humidity Event 55% 40% 10% Walking across carpet 7,500 V 15,000 V 35,000 V Walking across vinyl floor 3,000 V 5,000 V 12,000 V Motions of bench worker 400 V 800 V 6,000 V Removing bubble pack from PCB 7,000 V 20,000 V 26,500 V Packing PCBs in foam-lined box 5,000 V 11,000 V 21,000 V Many electronic components are sensitive to ESD. Circuitry design and structure determine the degree of sensitivity. The following packaging and grounding precautions are necessary to prevent damage to electric components and accessories. 5.2 • Transport products in static-safe containers, such as tubes, bags, or boxes to avoid hand contact. • Protect all electrostatic parts and assemblies with conductive or approved containers or packaging. • Keep electrostatic sensitive parts in their containers until they arrive at static-free stations. • Place items on a grounded surface before removing them from their container. • When handling or touching a sensitive component or assembly, ground yourself by touching the chassis. • Avoid contact with pins, leads, or circuitry. • Place reusable electrostatic-sensitive parts from assemblies in protective packaging or conductive foam. Personal Grounding Methods and Equipment Use the following equipment to prevent static electricity damage to equipment: • Wrist straps are flexible straps with a maximum of one-megohm +/- 10% resistance in the ground cords. To provide a proper ground, wear the strap against bare skin. The ground cord must be connected and fit snugly into the banana plug connector on the grounding mat or workstation. • Heel straps, toe straps, and boot straps can be used at standing workstations and are compatible with most types of shoes or boots. On conductive floors or dissipative floor mats, use them on both feet with a maximum of one-megohm +/- 10% resistance between the operator and ground. Static Shielding Protection Levels 5.3 Method Voltage Antistatic plastic 1,500 Carbon-loaded plastic 7,500 Metallized laminate 15,000 Grounding the Work Area To prevent static damage of components and parts in the work area: • Cover the work surface with approved static-dissipative material. Provide a wrist strap connected to the work surface and properly grounded tools and equipment. • Use static-dissipative mats, foot straps, or air ionizers to give added protection. Chapter 1 - - Before you Begin Page 37 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 5.4  INSTALLATION MANUAL • Handle electrostatic sensitive components, parts, and assemblies by the case or PCB laminate. • Handle components only at static-free work areas. • Turn off power and input signals before inserting and removing connectors or test equipment. • Use fixtures made of static-safe materials when fixtures must directly contact dissipative surfaces. • Keep work area free of non-conductive materials, such as ordinary plastic assembly aids and Styrofoam. Recommended Materials and Equipment Materials and equipment that are recommended for use in preventing static electricity include: • Antistatic tape, smocks, aprons, or sleeve protectors • Conductive bins, foam, tabletop workstations with ground cord of one-megohm +/-10% resistance, and other assembly or soldering aids. • Static-dissipative table or floor mats with hard tie to ground • ESD Field service kits • Static awareness labels • Wrist straps and footwear straps providing one-megohm +/-10% resistance • Material handling packages - Conductive plastic bags, plastic tubes and tote boxes - Opaque shielding bags - Transparent metallized shielding bags and shielding tubes Section 6.0 Important...X-Ray Protection X-ray equipment if not properly used may cause injury. Accordingly, the instructions herein contained should be thoroughly read and understood by everyone who will use the equipment before you attempt to place this equipment in operation. The General Electric Company, Medical Systems Group, will be glad to assist and cooperate in placing this equipment in use. Although this apparatus incorporates a high degree of protection against x-radiation other than the useful beam, no practical design of equipment can provide complete protection. Nor can any practical design compel the operator to take adequate precautions to prevent the possibility of any persons carelessly exposing themselves or others to radiation. It is important that anyone having anything to do with x-radiation be properly trained and fully acquainted with the recommendations of the National Council on Radiation Protection and Measurements as published in NCRP Reports available from NCRP Publications, 7910 Woodmont Avenue, Room 1016, Bethesda, Maryland 20814, and of the International Commission on Radiation Protection, and of any other local authorities, and take adequate steps to protect against injury. The equipment is sold with the understanding that the General Electric Company, GE Healthcare, its agents, and representatives have no responsibility for injury or damage which may result from improper use of the equipment. Page 38 Section 5.0 - Equipment Safety - Electrostatic Discharge (ESD)  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Various protective materials and devices are available. It is urged that such materials or devices be used. Section 7.0 Damage in Transportation All packages should be closely examined at time of delivery. If damage is apparent, write “damage in shipment” on all copies of the freight or express bill before delivery is accepted or “signed for” by a General Electric representative or any authorized receiving agent. Whether noted or concealed, damage MUST be reported to the carrier immediately upon discovery, or in any event, within 14 days after receipt, and the contents and containers must be held for inspection by the carrier. To file a report with GEHC: Call 1-800-548-3366 and use option 8. Section 8.0 Certified Electrical Contractor Statement All electrical Installations that are preliminary to positioning of the equipment at the site prepared for the equipment shall be performed by licensed electrical contractors. In addition, electrical feeds into the Power Distribution Unit shall be performed by licensed electrical contractors. Other connections between pieces of electrical equipment, calibrations and testing shall be performed by qualified GE Medical personnel. The products involved (and the accompanying electrical installations) are highly sophisticated, and special engineering competence is required. In performing all electrical work on these products, GE will use its own specially trained field engineers. All of GE’s electrical work on these products will comply with the requirements of the applicable electrical codes. The purchaser of GE equipment shall only utilize qualified personnel (i.e., GE’s field engineers, personnel of third-party service companies with equivalent training, or licensed electricians) to perform electrical servicing on the equipment. Section 9.0 Omissions and Errors Customers, please contact your GE Sales or Service representatives. GE personnel, please use the GEMS iTrak Process to report all omissions, errors, and defects in this publication. Section 10.0 Package and Service Toolket Purpose: Check all the crates appearances, preventive collision labels and preventive tilting labels. Chapter 1 - - Before you Begin Page 39 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL If the center of the preventive collision label is GREEN, it means the system is OK without any collision during shippment. If the center of the preventive collision label is RED, it means the system is not OK with collision during shippment. Please open the crates to check system carefully. Red Figure 1-2 Preventive Collision Label If the center of the preventive tilting label is GREEN, it means the system is OK without any tilting during shippment. If the center of the preventive tilting label is RED, it means the system is not OK with tilting during shipment. Please open the crates to check system carefully. Green Figure 1-3 Preventive Tilting Label Prepare the standard service toolkit Page 40 Section 5.0 - Equipment Safety - Electrostatic Discharge (ESD)  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Section 11.0 Tube and Generator Specifications 11.1 Tube Specifications Please refer to Technical Reference Manual 5331186-100 for details. 11.2 Generator Specifications Table 1-1 Generator Specifications Item Specs. VOLTS 380/480 Vac AMP, momentary 110/88 A AMP, long term 7/5.5 A KVA 70 KVA Phase/Hz 3Ph-50/60Hz Chapter 1 - - Before you Begin Page 41 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 42 Section 5.0 - Equipment Safety - Electrostatic Discharge (ESD)  INSTALLATION MANUAL  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Chapter 2 System Architect and Component 1 4 2 3 6 8 7 5 9 10 Chapter 2 - System Architect and Component Page 43  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Item Component Name Part Number 1 U-Arm for Brivo XR575 5420593 for GUA575 5420597 for GUA575-P 2 Collimator XS-1D 5429399-ROHS 3 Detector 5436666 4 Tube 5331186 5 Console 5429246 6 Cabinet(PDU and Generator) 5429116 7 Workstation 5810000-A or 8770000-11 8 Monitor 5498484 9 Stretcher table 5428952/5428953 Note: Page 44 The imaging resolution is 5pix per 1mm. The Imaging area can be larger than 404*404mm. -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Chapter 3 - System Installation Guide and Checklist The primary tasks are designed to be performed in sequence. Follow the sequence of tasks describe for each primary task in Section 1.0 that follow. Section 1.0 Installation 1 Receive and Inventory System People Required: 1 Minutes to Complete: 10 Inventory equipment & report discrepancies immediately. 2 Uncrate, Inventory and move them to room People Required: 2 Minutes to Complete: 60 Collect Product Locator Cards and store in a secure location. Uncrate and Inventory subbox. Plan route and transport equipment to room. 3 System cabinet positioning and fix Arm People Required: 2 Minutes to Complete: 45 Lift and move the cabinet to the designed position by service tool. Lift and move the U-Arm to designed position by service tool. Install the topbox to fix the U-Arm. 4 Detector component installation and cable connection People Required:2 Minustes to Complete:45 Take out detector housing from shipping container. Install detector housing to the U-Arm. Install the Tube support to balance the U-Arm Install ion chambor(optional), detector and connect cables Mount in the covers and route the cables between the detector housing and U-Arm Grid in/out to test whether the function is good. 5 Tube and collimator installation and cable connection People Required:2 Minutes to Complete:20 Take out tube and collimator from shipping container. Put the tube on the tube support Connect the collimator to the tube Connect and routing cables, then wear the cable sleeves. Mount in the covers Chapter 3 - - System Installation Guide and Checklist Page 45  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 6 INSTALLATION MANUAL (Continued) People Required: 2 Cable connection to Top Box Minutes to Complete: 30 Install the limit switch on column. Install the cable support on topbox Connect and routing cables, then wear the cable sleeves 7 Cabinet Cable Routing and Connection Open the Cabinet cover People Required: 2 Minutes to Complete: 10 Connect cables to Cabinet. 8 Workstation and Console installation People Required: 2 Minutes to Complete: 15 Position and connect Workstation computer, Console and accessories. Including any purchased equipment (i.e.Bar Code Reader) options. 9 Table unpacking and installation Unpacking the table box and complete installation People Required: 2 Minutes to Complete: 10 10 System power on and positioner check Power on the system People Required:1 Minutes to Complete: 30 Make image chain alignment Couterweight 11 Final cover installation People Required: 2 Minutes to Complete: 15 12 Configuration and calibration People Required: 1 Minutes to Complete: 40 Configure the equipment Calibrate the equipment 13 Data backup for restore People Required: 1 Minutes to Complete: 10 14 System Checks People Required: 1 Minutes to Complete: 20 Do system checks after system configuration and calibration. 15 16 If necessary, attach Warning Labels and Rating People Required: 1 Minutes to Complete: 5 Plates If your country requires to attach especial labels, please find them in accessory box and attach them in site under the instruction in chapter 9. If your country requires the product rating plate to be in the language of that country, follow the instructions on document #45474336. Paste the appropriate language label over the English rating plate. Cleanup Site People Required: 1 Remove and dispose of shipping materials and tools properly. Page 46 Section 1.0 - Installation Minutes to Complete: 20  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 17 INSTALLATION MANUAL (Continued) People Required: 1 Customer Turnover Minutes to Complete: 10 Complete & Return Product (i.e; Locator) Cards. Perform general house keeping tasks and turn system over to user. 18 Complete Installation Checklist People Required: 1 Minutes to Complete: 10 Field Engineer to fill out installation checklist at completion of installation. Lead is used in this system to provide required radiation shielding, such as in tube, collimator, please pay attention and do not touch it directly. Section 2.0 Installation Checklist Purpose: Installation checklist to confirm that all critical installation steps have been completed. Item # 1.) Item Power and ground cables connected and tightened: Power cables (how many?, where?) Ground cables (how many?, where?) 2.) All signal cables connected and tightened. 3.) Cable shield clamps installed and tightened (how many?, where?). 4.) All mounting bolts installed and tightened (floor and wall). 5.) Collimator alignments done. 6.) Detector installed and connected. 7.) Control room cables properly dressed. 8.) Correct language decal applied to workstation. 9.) All covers installed. 10.) Room cleaned. 11.) Product locator cards collected. 12.) Missing components and/or options: 13.) List of any installation drawing deviations (all deviations should be signed by customer and reviewed by the installation specialist). 14.) Packing materials disposed of. 15.) Service Tool returned Chapter 3 - - System Installation Guide and Checklist Page 47  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Item # Item 16.) Detent marks and labels attached. 17.) Have all calibrations been completed? 18.) Have the sample images been installed on the system? 19.) Have purchased options been installed/enabled/configured? 20.) All appropriate regulatory labels installed: X-ray tube focal spot Warning labels Rating plates 21.) InSite checkout completed? 22.) Have functional checks been completed? 23.) Are all covers installed? 24.) Have all protective tape/coverings been removed? 25.) Are there any appearance issues? 26.) Are there any system issues? 27.) Are there any functional limitations? 28.) Has system documentation (paper and CDROM) been given to the customer? 29.) Is the hospital scheduling system (HIS/RIS) configured? Does the modality display MWL (Modality WorkList) responses successfully? 30.) Are printers configured and printer calibrations done on ALL printers? 31.) Are PACS configured and SMPTE and/or test images pushed to system for successful display (be sure burn/no burn is properly set for PACS)? 32.) Has local physics inspection been completed. Some states/sites may not allow use of system for patients until this is done. 33.) Has backup of system been performed when initial installation? (Patient Data Base as well as total system backup) 34.) Has Field Engineer completed all checklists: Installation checklist Page 48 Section 2.0 - Installation Checklist  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Chapter 4 Service Tool Instruction Section 1.0 Component Service Tool Component Transporting dolly Foldable Crane Fixed plate One bar One bolt Wrench One axle Alternate bar, bolt and axle Two yellowbelts Two small bolts Chapter 4 - Service Tool Instruction Page 49  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Table 4-1 Parts checklist of SVC tool collection NO. Parts for collection attention Quantity where used for SVC Tool 1 Limit shaft with pin 2 Foldable crane 2 Arm length limit shaft with pin 1 Foldable crane 3 Bars (with 2 nuts for each) 2 Transporting dolly 4 Bolt 1 Transporting dolly 5 Wrenches 2 Transporting dolly 6 Axle (with 2 screw rings for each) 2 Transporting dolly 7 Small bolts 4 Transporting dolly 8 Screw stems (with 2 nuts for each) 2 Transporting dolly 9 Yellow belts 2 Transporting dolly 10 Binding belts 3 SVC Tool fixing Section 2.0 Installation Please refer to: Chapter 5 - System Hardware Installation-Section 1.0 U-Arm Positioning for Service tool usage. Section 3.0 Planned Maintenance 3.1 Foldable crane maintenance: 1.) Use only on the hard and flat ground; never use on the soft ground. 2.) Lifting loads must not exceed the rated load. 3.) The rated load of foldable crane will be reduced when the crane arm is in the extension process; the rated load of every adjusted position is indicated on the label and prohibit use of overloading. 4.) Make sure the arm fixed on the firmly position by the fixed pin before lifting. 5.) Equipped with elastic lock mechanism on the hook; ensure the lock proper function before lifting. 6.) Ensure the load smooth and stable before lifting; the center of gravity of the load is always in the correct below of the hook. 7.) Prohibit standing in the below of the hook and load. 8.) Do not allow the load violent shaking or falling when moved. 9.) Foldable crane is not special tool used to transport or move goods; if necessary to be moved, lower the load and jib height as low as possible before moved. 10.) Foldable crane is not a tool used for sustain the load indefinitely, so remove the load promptly after each operation completed. 11.) Visual inspection carefully before every used; if there is any damaged or abnormal, please Page 50 Section 1.0 - Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL submit to repair in time. 12.) Check the hydraulic cylinder of foldable crane whether oil spill before and after every used; if leaking, stop using and submit to replace hydraulic cylinder. 3.2 Transporting dolly maintenance 1.) Must be used on flat ground. 2.) Do not allow to crash when used. 3.) Do not allow water touch in use; if it is touched in water in case, dry cleaning and lubricate. 3.3 Rotating shaft and shaft hole maintenance 1.) After used, carefully check the device to collect the various components and soldering whether is normal and check the rotating shaft(drawing number:ST37-07DDW and ST37-13DDW) and the work surface of the shaft-hole match whether is damaged; if there are some problems, replace the parts or repair in time. 2.) After used, lubricate Hinge and the work surface of the shaft-hole match. 3.4 Lifting belt maintenance 1.) Do not allow overload. 2.) Do not use any breakage aging and defective. 3.) Highly corrosive chemical solvents or high temperatures will damage belt and weaken the safety of the belt. 4.) Lifting heavy objects as smooth and slow as possible to prevent lifting force suddenly. 5.) Lifting objects with sharp edges will likely cut the belt so it should be worn protective liner. 6.) Lifting belt should be placed in a dark place when sustained not work indefinitely. 3.5 Overall transport considerations 1.) After finished, must put the foldable crane fix shelves using trapped ties before the packing. 2.) Put the transport rack as a whole onto the wooden pallet, and fix it on the wooden bottom bracket to ensure the whole not be traversed up and down. Chapter 4 - Service Tool Instruction Page 51  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 52 INSTALLATION MANUAL Section 1.0 - Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Chapter 5 - System Hardware Installation Section 1.0 U-Arm Positioning Be careful of injured by the nails. Note: • Do not discard any packing materials such as envelopes, boxes, bags until all parts are accounted for against the packing list. • Check the mechanical conditions and external appearances of all parts for possible damages or missing items. • The distribution center or factory must be notified immediately for any damage or shortage of parts.’ Unpacking OPEN ME FIRST box (Pink Box) in Crate #1 at first. The "OPEN ME FIRST" box is in the accessory package. There are manual CD, SW CD, local languages system labels and other accessories in this package.Take out the Operator and Service Documents and CD. Read Manuals carefully before system installation and calibration. Chapter 5 - - System Hardware Installation Page 53  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL 1.) Loosen the corner protectors on the corner of shipping container. Figure 5-1 Loosen corner protectors 2.) Remove the top and side of shipping container, and Arm is bound on it. See Figure 5-2. Page 54 Section 1.0 - U-Arm Positioning GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-2 Table Crate with top and side plate Removed 3.) Remove the protective covering with the scissor. Chapter 5 - - System Hardware Installation Page 55  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-3 Remove the Protective Covering 4.) Take out the wood fixtures and metal fixtures in the crate. Figure 5-4 Take Out All the fixtures in the crate 5.) Move out the column cover beside the Arm Page 56 Section 1.0 - U-Arm Positioning GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-5 Remove the colulmn cover 6.) Use the service tool to move the U-Arm to the position. a.) Open the service tool packing box. b.) Relax the cords fixed around the service tool. c.) Brake the casters and lift up the foldable crane Chapter 5 - - System Hardware Installation Page 57  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL d.) Remove the bolt and axle from the ring in the transporting dolly. e.) Remove the bar from the ring to move out the ring from the transporting dolly. And then fixed the bar back to the dolly. Page 58 Section 1.0 - U-Arm Positioning GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 f.)  INSTALLATION MANUAL Remove out the bar from the dolly to take out the lifting ropes g.) Insert the axle to the hole in the bottom of the column. h.) Insert the axle trough the hole in the top of the column. Chapter 5 - - System Hardware Installation Page 59  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL i.) Set the two ropes crossingly from one side in the bottom axle to another side in the top axle j.) Unfold the foldable crane. * Screw off the bolt from the crane to put down the carrier and then fix back the bolt to the axis carrier * Draw out the pin and Strench out the lifting hook to the number 3 position. When draw out the pin, please hold the hook to avoid to hit feet. Page 60 Section 1.0 - U-Arm Positioning  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Pin k.) Relax the brake on the wheel. Adjust the lifting arm height by hold the bar up and down to lift the U-arm off to the transport cart. hold the bar l.) Block the bottom of the column to the bar on the cart. Chapter 5 - - System Hardware Installation Page 61  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL m.) Install the ring to the top of the column n.) Bundle up the Arm and cart together. put the hook under the cart to avoid scrape. o.) Push the dolly with the U-arm to the position. p.) Rotate the U-arm away from the center and connect the hook on the lift arm to the ring. Page 62 Section 1.0 - U-Arm Positioning  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL q.) Lift up the column by foldable crane. r.) * If you don’t need to enter the elevator, please go to the step r. * If you need to enter the elevator, please go to the step s. When the column is lifted up to 45° off the ground, put up the tripot on the cart to support up the column. * Remove the bolt on the column. Slide * Remove out the pin on the tripot. * Put up the tripot and fix it to the column by tightening a bolt with a wrench. Chapter 5 - - System Hardware Installation Page 63  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL * make the bottom of the column off the ground by the bar across the dolly. * Remove off the foldable crane and push the U-arm into or out of the elevator then. * When reach to the position, connect the foldable crane to the ring on the column and put down the tripot. s.) Using the foldable crane to make the column stand on the position. t.) Lift up the U-Arm off the ground and rotate the column to front u.) Pull down the lift arm by screw the knob on the foldable crane to disconnect the crane with the ring on the column. Page 64 Section 1.0 - U-Arm Positioning GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Knob 7.) Pull the arm down the ground and return to the front. Figure 5-6 Position the Arm 8.) Move the other crate and take out the system accessories Chapter 5 - - System Hardware Installation Page 65  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-7 Unpacking System accessories crate. 9.) Refer to the room layout in Pre-Installation Manual, confirm the location of the column with Arm. 10.) Remove the protective covering and take out top box. Page 66 Section 1.0 - U-Arm Positioning  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL 11.) Install the top box to the top of the U-arm column - Relax the three M8 screws in the top back of the column - Open the top and front cover from the topbox - Reach the three holes on the topbox into the screws on the column to hang the topbox on the column. - Tighten up all the three screws with no less than 20NM tightening force Top view of the column Open the topbox covers Hang on the topbox on column Figure 5-8 Install the top box to U-arm column 12.) Drill six Φ15mm holes at least 65mm deep into the ground concrete (not contain the tile or protective layer) without removing away the column, the 15mm's drill bit is enclosed with the package, and then clean the holes of all dust and chips. Anchors require a minimum engagement of 65mm into the concrete. If the concrete thickness is less than 110mm, it is recommended to weld or screwed a big steel plate under the column bottom. The Big steel is not the basic accessory, please ask support from the service engineer for special preparation. Chapter 5 - - System Hardware Installation Page 67  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Six holes in column baseboard Figure 5-9 Drill the holes into the floor v.) Note: Insert the expansion nuts into the 6 holes with hammer lightly till the expansion fully sink into concrete (allow2-5mm below, such as Picture1 step2),screw in the M12*80 bolt (with washer) into the expansion nuts and. Adjust the bottom plate level then tighten the six anchor with 50NM-60NM torque. The M12*120 bolt will be used instead in case of 20-40mm thickness ceramic tile paving. Figure 5-10 Process of fixing the baseboard by anchor bolts w.) Install the baseboard cover. Page 68 Section 1.0 - U-Arm Positioning  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL 1 2 Finished image Section 2.0 Detector Housing Component 2.1 Unpacking Remove the protective covering and take out detector housing. 2.2 Installation 1.) Screw off the Lock/Release handle of detector housing from the U-Arm Figure 5-11 Release handle of detector housing Chapter 5 - - System Hardware Installation Page 69 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL 2.) Insert detector housing to U arm. Detent box Figure 5-12 Insert detector housing to U-Arm 3.) Firstly remove the cover of the detent box. Find a tool to press the detent into the detent box.Direct the notch on the plate of the detector housing to the detent on U-Arm.Install the detect box cover back. Page 70 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-13 Direct to the detent 4.) Install the Lock/Release handle of detector housing Chapter 5 - - System Hardware Installation Page 71  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-14 Install the Lock/Release handle of detector housing 5.) Make the detector vertical to the floor by release the handle to rotate the detector housing. Lock Release Figure 5-15 rotate the detector housing Note: When the detector housing is vertical to the arm, the detent will be in fixed position. 6.) To balance the U-Arm, install the tube support. Page 72 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Align the Tube support to the marked lines on U-Arm Marked lines Chapter 5 - - System Hardware Installation Page 73 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 2.3 Cable connection 1.) Screw off the back cover of the detector housing. Figure 5-16 screw off the back cover of detector housing (before) Figure 5-17 screw off the back cover of detector housing (after) 2.) Open the detector housing front cover. Page 74 Section 2.0 - Detector Housing Component  INSTALLATION MANUAL GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-18 Open the detector housing front cover 3.) Insert cables (5428934, 5428629, 5428859, 5433031) from the back of U-arm into detector housing.And Don't insert all the length into the detector housing. leave the cables out of the detector housing about600m Figure 5-19 Insert cables into detector housing Chapter 5 - - System Hardware Installation Page 75  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Detector Housing Cable Routing 1. Detector signal cable (5428629) 2. detector power cable (5428934) 3. Detector ground cable(5428859) 4. E-stop cable(5433031) 5. Ion Chamber cable (5437495) 6. Handle button cable(5433031 to button) E-Stop cable Note˖ 1. Please tie the cable under the illustration 2. Directly plug in the fan cable to detector housing fans Figure 5-20 Cable routing in detector housing 4.) Connect cable(5428647) to two fans Figure 5-21 Connect cables to two electric fans 5.) Connect the receptacle plug(5433031 to Grid-in SW) into the micro switch of grid in/out. Page 76 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-22 Plug in grid in/out switch 6.) Put the cable(5433031 to button) in the wire slot under the detector housing. Figure 5-23 Cable connection to button 7.) Route the other cables in the detector housing. Figure 5-24 Cable route 8.) Install the Ion chambor with the cable into the housing firstly. Chapter 5 - - System Hardware Installation Page 77 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL DO NOT put anything onto the detector rail. a.) Remove the block on the slide. Bottom block Ion chambor slide rail Figure 5-25 Remove the block on the slide rail b.) Slide in the ion chambor Figure 5-26 Slide in the ion chambor c.) Cable conncection(5437495) to the ion chambor Page 78 Section 2.0 - Detector Housing Component Up block GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-27 Ion chambor cable connection d.) Screw off the nuts and fix the ground cables on the U-Arm e.) Fixed back the blocks in the detector housing. 9.) Install the detector a.) Unpack the detector package. Figure 5-28 Detector Chapter 5 - - System Hardware Installation Page 79 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL b.) Move off the block and relax the four clamps c.) Slide in the detector d.) Connect the cables (5428934, 5428629,5428859) Ground Cable 5428859 Figure 5-29 Cable connection to detector e.) Mount on the block and fix the four clamps 10.) Install back the back cover. 11.) Connect the cable (5433031 to button)to handle button. 12.) Connect the cable (5433031 to E-stop)to emergency button on the front cover. 13.) Slide in the grid to the two rails respectively in the detector housing to check whether it can be Page 80 Section 2.0 - Detector Housing Component  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL inserted without any difficulty. Two grid rails Figure 5-30 Finish detector component installation 14.) Route the cables between the detector housing and U-Arm 15.) Wear the cables sleeve. One end of Detector housing cables ties position SID sleeves ž30h800 No cable ties inside The other end ties to slide Length 600-620mm For all cables in detector housing side Figure 5-31 Route the cables and wear the sleeves Chapter 5 - - System Hardware Installation Page 81 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Section 3.0 X-ray Tube and Collimator 3.1 Unpacking Be careful of injured by the nails. • Do not discard any packing materials such as envelopes, boxes, bags until all parts are accounted for against the packing list. • Check the mechanical conditions and external appearances of all parts for possible damages or missing items. • The distribution center or factory must be notified immediately of any damage or shortage of parts. 1.) Loosen the fibulaes and remove the crate. See Figure 5-32. Figure 5-32 Loosen Fibulaes and Remove Crate 2.) Open the upper cover of the tube box. Page 82 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-33 Open the upper cover of tube box 3.) Take out X-ray tube from the box. Figure 5-34 Take out the Tube from the box 3.2 Installation 1.) Open the package of the collimator 2.) demount the plastic board on the collimator, snip the cable ties which fixed the two pairs of lead blades, then test if the blades can operate normally, mount the plastic board Chapter 5 - - System Hardware Installation Page 83  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-35 Snip the cable ties in the collimator 3.) Remove the flange from the collimator. Note: Don’t remove the clamps off the collimator, just remain it on the collimator for next reinstallation. Figure 5-36 Remove the flange from the collimator 4.) Install the washer into the bolt enclosed with the collimator Bolt Washer Well installated 5.) Put the tube on the tube support. Page 84 Section 2.0 - Detector Housing Component  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-37 Put the tube on the tube support Notice the tube installation direction. If the direction is wrong, the tube focal spot will be inaccurate, and the tube may be falling down if the clamps are loose. Hold the tube to prevent it from falling down. 6.) Install the flange with four bolts to fix the tube and connect with collimator. At the bottom of the tube support Figure 5-38 Fix X-ray Tube 7.) Rotate the tube support 180 degrees to make the flange up. Chapter 5 - - System Hardware Installation Page 85 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-39 Rotate Tube Support 180 Degrees 8.) Mount 3 bolts/washer and 2 clamps into Collimator flange, bolts inserted depth should be 1~2mm. Note: In order to securely mount the collimator, please add Loctite 242 to the screws on the clamps. Figure 5-40 Mount Bolts and Clamps to Collimator 9.) Put collimator on tube stand, pull out the unfixed clamp to have more area to insert collimator into the collimator flange which is fixed on tube before. Page 86 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-41 Mount collimator on tube 10.) Fix all the 4 bolts to fix connection between tube and collimator. Tightening torque for preload 5.5Nm. 11.) Rotate tube support back. Chapter 5 - - System Hardware Installation Page 87 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Figure 5-42 Rotate Tube Support Back 12.) Install the Cable support on tube support. Figure 5-43 cable support on tube support 13.) Install the other cable support on the Arm Page 88 Section 2.0 - Detector Housing Component  INSTALLATION MANUAL GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-44 cable support on the Arm 3.3 Cable connection 1.) Remove the cable support cover. Figure 5-45 Remove the cable support cover 2.) Route the cable(5428663,5428636,5428666 and HV cables) through cable support to the tube side. Back Front Figure 5-46 route cables through cable support 3.) Wind the cables around the cable support. Chapter 5 - - System Hardware Installation Page 89  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL 4.) Prior to the connection of the high-voltage cables, remove the old silicone compound on the plug surfaces with clean dry cloth and confirm that there are no cracks, flaws, or traces of creeping discharge on the surfaces. Note: When the traces of creeping discharge are found, be sure to replace the defective parts. (Grinding off the traces only will not be effective.) 5.) Coat the tip of the cable plugs with the silicone compound about five to seven grams, that is, to the extent the tip is hidden under the heaped up compound. At this time, the side of the cable plug should not be greased. Figure 5-47 Coating with Silicone Compound 6.) Remove the cap covered the socket of the tube housing and wipe the inside softly with a clean dry cloth. DO NOT use any chlorinated solvents to clean any parts. 7.) Install the HV cables(5122632) to the anode side and cathode side. HV Cable Socket HV Cable + (ANODE) + - (CATHODE) - Check the polarity of HV cables carefully, and DO NOT connect the two HV cables reversedly. Page 90 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Connect the HV cables in the correct polarity with sufficient care not to produce interstice between the cable plug flange and the cable socket at the insertion of the plugs. Presence of such clearance or incomplete silicone compound coating will cause creeping discharge and normal operation of tube will be disturbed. Figure 5-48 Inserting Cable Plug 8.) Tighten the high-voltage cables solidly to the sockets of the tube housing by the threaded cable flange. The elapse of time and repeated temperature rise of the tube housing may loosen the fastening portion, it is necessary to fulfill periodical checking and retightening of the fastening after the initiation of the operation of the X-ray tube. As a periodical maintenance means, the high-voltage plugs and sockets must be regreased in every 14 months. When regreasing, the operation should be repeated from the foregoing item 7). 9.) Demount the tube cover on Anode side. Chapter 5 - - System Hardware Installation Page 91  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Figure 5-49 Demount Tube Cover 10.) Connect the anode rotation cable (5428666). Note: Fix the cable with clamp. Figure 5-50 Anode Rotation Cable Conections Tube HV Tank 1 C 2 M 3 A SW SW SW SW E E 11.) Remount the tube cover. 12.) Connect the cable(5428636 to button ) to handle button on tube side . Page 92 Section 2.0 - Detector Housing Component  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Cautions: Don’t make the cables pass through the notch on the cable support. Otherwise the cables will wind with the axle of tube support what will cause some serious faults Figure 5-51 Cable connection from spine board to tube side button. 13.) Connect collimator power cable(5428663). Figure 5-52 connect collimator power cable 14.) Connect LCD cable and ground cable. 1:For routing from Topbox to PDU 2:For routing all cables from tube side 3:For routing high voltage cables and collimator power cable in tube side 4:For routing all cables from Arm in detector housing side 5:For routing other cables in tube side 6:For routing cables from Arm in tube side Chapter 5 - - System Hardware Installation Page 93  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Display cable 5428636 Groud cable 5428636 Figure 5-53 LCD cables 15.) Route the cables and package the cable sleeves. 6 1 Page 94 2 3 4 Section 2.0 - Detector Housing Component 5  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Tube cable routing and package Cathode side sleevež30h500 First Step Anode sidecable 1. High voltage anodecable 2. Handle button cable 3. Rotating anode cable 4. Collimator power cable Anode side sleevež50h650 Second step Butt plug protection Third step Bind cathode and anode cables Binding position Binding sleevež60h Fourth step Fix the binding sleeves and put it through the cable support Left 1000-1100mm length Chapter 5 - - System Hardware Installation Page 95  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Fifth step Tube Cables ties with U-Arm cables No cable ties Sleeves with zipper ž55h6200 U-Arm sleeves ž35h150 Tube Cables ties with U-Arm cables Figure 5-54 Route the cables on tube support 16.) Install the tube covers. Page 96 Section 2.0 - Detector Housing Component GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-55 cover installation Section 4.0 Cable Connection to Top box 1.) Install the limit switch(5448734). 1.) Open the cover on the limit switch 2.) Connect the cables to the limit switch Chapter 5 - - System Hardware Installation Page 97  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL 3.) Screw it on th column No + - Pole Common and NO terminals don’t install in this hole. 2.) Open the top box cover. Install the cable supports to the top box. Cables onto the cable supports Figure 5-56 Install the cable support 3.) Route the cables onto the cable supports. 4.) Insert the cables (5428931,5428934,5428631,5428663,5429133,5428665,5492121,5492123) through the clip and plug them into the related interface. Page 98 Section 2.0 - Detector Housing Component  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL Ground cable: 5492123 5428665 Ground cable: 5492121 Cable clip Figure 5-57 Cable Connection on Top Box 5.) Moute on the top box cover 6.) Route the cables and package the cable sleeve. Tie the cable in this position. Section 5.0 Cabinet Electrical Connections For details, please refer to System Schematics and Drawings in Service Manual and PreInstallation Manual. Note: The handle on each side of the cabinet only used to lift off the cover. Don’t move the cabinet by the two handles. 1.) Bind the PDU by the included belts with dolly, lift the PDU by dolly and put it on the foldable crane to move it to the right place. 2.) Open the PDU cover to expose the system by the below way. a.) Insert the slotted screwdriver into the slit beside the breaker cover on the PDU and snap Chapter 5 - - System Hardware Installation Page 99 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL the cover from the PDU. b.) Screw off the 8 screws fixed on the PDU,hold on the handles beside the PDU, lift up one side of PDU cover without the breaker cover firstly. Pay attention that the handles on the cabinet are only used for lifting the cover, but not to move the whole cabinet. Please position the cabinet carefully and do not move it casualy. It is better to move it by qualified engineer. c.) Push the PDU cover from the lift up side to the other side with breaker cover.Then the breaker will be hided inside the PDU cover. d.) Lift the PDU cover and expose the inside system. Page 100 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL 3.) Connect and route System Power Cable and Grounding cable.(hospital provide). Figure 5-58 Connect and Route System Power Cable 4.) Connect and route cables to Jedi. Chapter 5 - - System Hardware Installation Page 101  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL HV cable 5122632 Jedi X-ray On Lmp Cable 5432235 IF board to Jedi Cable 5428664 Ion Chambor(AEC1) cable 5437495 Tube Rotator cable 5428666 Figure 5-59 Connect and Route Cables to Jedi 5.) Connect and route cable to PDU Page 102 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL IF Board: IF powercable to PDU 5428661, IF board to Jedi able 5428664, IF board to Spine board cable 5428632, IF board to PC RS232 , cable 5428628. IF broad to Console cable 5428630, Room-door open switch cable 5432234 J2+J3: PC power cable 5428622 J1:U-Arm power cable 5428631 J4:IF power cable 5428661 Room-door open switch cable 5432234 Jedi X-ray lamp On cable 5432235 Figure 5-60 Connect and route cable to PDU 6.) Ground cable(5478018) between PDU to PC Chapter 5 - - System Hardware Installation Page 103 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Section 6.0 - Workstation and Console Installation 6.1 Computer 1.) Placement 2.) Connections(USB/PS2) 5428622 HP LaserJet P2055d printer Bar Code Reader Ground cable 5428628 5428629 cable connected to moniter Figure 5-61 Magic PC Connections 6.2 Mouse and Keyboard 1.) Placement 2.) Connections (USB/PS2) 6.3 Console & Handswitch 1.) Placement 2.) Connect IF (System Cabinet) to console(cable 5428630). 3.) Connect Handswitch to console. 4.) Change the warning label on top of console(No need for China) a.) Remove the default Chinese warning label from the console. b.) Take out the suitable label from the accessory box. Page 104 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL 5.) Paste the right label on the warning label position. Figure 5-62 Console component IF to Console cable 5428630 Handswitch cable Warning label position Figure 5-63 Console cables connection 6.4 LCD Monitor 1.) Placement 2.) Connections a.) Video (DVI) b.) Power & Ground 6.5 Bar Code Reader (Purchased Option) 1.) Placement 2.) Connections Chapter 5 - - System Hardware Installation Page 105  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 6.6 Part No. INSTALLATION MANUAL Workstation Cable Connections Description Workstation TO References 5428628 PC RS232 cable Magic Com port System IF See Figure 5-61 5428629 PC ethernet cable Magic PC Gb-E Detector See Figure 5-61 card 5428622 Image Monitor power Cable Monitor PDU J2 See Figure 5-61 5428622 Magic PC power cable Magic PC PDU J3 See Figure 5-61 Table 5-1 Workstation to Wall Box Section 7.0 System Cable Connection JEDI PDU Cabinet Door Tank 5432235 5432234 5122632(2pcs) or 5393036(2pcs) GND STATOR DC BUS 70ഒ 5428622 PC MONITOR J3 5428622 PC HOST Xray on X-Ray Light J2 J4 J1 IF PWA AEC1 J1 5428666 J2 J3 J6 Door LOCK 5428661 U V W GND J5 J4 J5 5437495 Door lock switch Main power 5478018 5428631 5428628 Topbox(on column top) P1 Hand SWITCH PN:5439061 5428665 5435323 Servo P5 5435322 5428630 Power motor 5428632 P2 5429133 5428931 P3 J4 J1 TM CONSOLE PN:5429246 P4 5428663 Collimator 5428934 5428629 PN:5428859 J12 Detector Ion chamber Housing Grid in E-stop button 5433031 Fan 5428647 J6 J7 J2 Spine PWA (in the Arm) PN:5430961 J9 5428645(Brivo575P/575) 5447187(Brivo515) Tube J4 J5 J10 J1 5435324 J8 5428635(Brivo575P/575) 5428639(Brivo515) J13 5428638(only for 575P) 5428636˄Brivo 575P/575) 5428637(Brivo 515) Rotation LOCK Vertial POT(PN:5428672 ) SID POT (PN:5428673) Angle meter LCD PN:5430986 SID LOCK PN:5447915 Button Console LCD PN:5430979 Vertical lock And limit switch Note: U-ARM Connectivity xxx.xxx connect cable and part number Power supply Section 8.0 Cover Installation Purpose: This chapter is only used for Brivo XR575-P. Page 106 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.)  INSTALLATION MANUAL Unpack Column Covers Figure 5-64 Unpacking U-Arm covers top cover support screw M5*12 Front cover support screw M5×8 Side cover support screw M4×8 Figure 5-65 Cover installation illustration Chapter 5 - - System Hardware Installation Page 107 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 2.) Install the cover on top of the column Figure 5-66 top cover installation 3.) Install the side cover and front cover on the column Page 108 Section 5.0 - Cabinet Electrical Connections  INSTALLATION MANUAL GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Section 9.0 Table Assembly 1.) Screw off the bolt on top cover of the table box. Figure 5-67 Unpacking the package of table 2.) Take out all of the table accessories Figure 5-68 take out table accesories 3.) Install the two side brackets on the table top a.) Insert the screw through the hole on the table leg as illustrated. Figure 5-69 Insert the screw on the table top plate Chapter 5 - - System Hardware Installation Page 109 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL b.) Mount on the table legs and turn the screw tight. Figure 5-70 install the table Don’t tighten the screw with more than 15Nm torque. Section 10.0 Power On and Positioner Check 10.1 Alignment 10.1.1 Image chain alignment check. The image chain alignment has been conducted before delivery to customers. Normally it is good for image acquisition. But it still need to have a check before usage to ensure no any trouble involved for transportation issues. The checking method is to see whether the projected cross lines from collimator light field is aligned with the cross lines on the detector housing panel. 1.) Power on the system and open the collimator lamp 2.) Fix one collimator FOV and shrink the other FOV untill the light field is zoom out and just covered by the line on the plastic plate. Observe the projected dark line on detector housing panel and to see whether it aligns with the cross line marked on the center of detector housing - Page 110 If the projected cross line is not align with the cross line on detector housing panel, you must conduct the image chain alignment once again. Otherwise, it will impact image acquistion. Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 10.1.2  INSTALLATION MANUAL Image chain alignment procedure 1.) Align the X-ray light to the detector. a.) Power up the system. b.) Check the tube support is connected with Arm slide close to the line marked in Arm slide. c.) Rotate the Arm to horizontal position. Chapter 5 - - System Hardware Installation Page 111 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Figure 5-71 Position the Arm d.) Set the FOV of collimator to 30*30cm e.) Expose one time. As illustrated below, the black range is X-ray light imaging area, and the outside white range is detector panel area. f.) Page 112 Go to viewer screen and click [Image-Raw] menu, then open the menu [Annotations / mask] to draw two diagonal lines on the detetor area and x-ray source area respectively. Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL Point A Diagonal lines in xray source area Point B Diagonal lines in detector panel area g.) Comparing the point A and point B in the image to judge whether the bias of the center is less than 10 mm. If the bias is within 10mm, then you don’t need to do the next steps for alignment between x-ray and detector. Otherwise, please go next steps. h.) If point B is left or right to the point A, then relax the four nuts(circled in blue as illustrated) and adjust four screws(circled in red as illustrated) Chapter 5 - - System Hardware Installation Page 113 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 i.) j.)  INSTALLATION MANUAL If point B is up or down to the point A. * first judge according to the above way whether the bias is in the same level on SID100cm and 180cm. If it is, then relax the four nuts(circled in blue in above figure) and adjust the position of the tube support. * If the bias are not up or down in same level, then relax the two screws (circled in blue as illustrated) , then relax the two little bolts which is used to fix the position(circled in red as illustrated). Rotate the Arm to 90 degree and conduct collimator alignment under the same way. 2.) Align the collimator light field with X-ray field a.) U-arm set to 0 degree. SID set to 100cm, collimator FOV set to 30cm x 30cm. Do not Page 114 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL change the FOV in the following steps. b.) Place 4 metal objects to mark the 4 edges of the light filed. c.) Create an exam and take an exposure with 120kVp 2mAs. Select the raw image acquired and adjust WW / WL. Chapter 5 - - System Hardware Installation Page 115 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  INSTALLATION MANUAL d.) Check if the edges match with each other between the metal objects and the X-ray field. If not, adjust the positions of the metal objects. Take exposure again to check until the edges matches. Do not change the metal objects positions in the following steps. e.) Remove the back cover of the collimator, adjust the positions of the light filed as shown, until the edges matches between the light filed and metal objects. Page 116 Section 5.0 - Cabinet Electrical Connections GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 f.)  INSTALLATION MANUAL Install the back cover, then the alignment procedure ends. 3.) Light the collimator lamp. Check whether the line in the collimator plastic plate is aligned with the crossing in the detector panel. - Fix one collimator FOV and shrink the other FOV untill the light field is zoom out and just covered by the line on the plastic plate. Observe the projected dark line on detector housing panel and to see whether it aligns with the cross line marked on the center of detector housing. If not, loosen the plastic plate and adjust it. Chapter 5 - - System Hardware Installation Page 117 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 10.2  INSTALLATION MANUAL Couterweight Purpose: The counterweight has been finished before delivery. It usually don’t need to do this step in fields. Just in case the equipment can’t keep balance , adjust the weight of either side of the Arm and the back of the column under the instructions in this chapter to balance the equipment. 1.) If the Arm can’t be level in 0°, add or reduce the counterweights in detector housing side of Page 118 Section 5.0 - Cabinet Electrical Connections  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 INSTALLATION MANUAL the Arm. counterweight 2.) If upward force and downward force for column aren't balance, move the Arm to top position, open the counterweight cover on the back of the column, add or reduce the counterweights. 10.3 Installation Checklist Purpose: Installation checklist to confirm that all critical installation steps have been completed. Item # 1.) 2.) Item Power and ground cables connected and tightened: • Power cables (how many, where) • Ground cables (how many, where) All signal cables connected and tightened. Chapter 5 - - System Hardware Installation Page 119  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Item # Item 3.) Cable shield clamps installed and tightened (how many, where). 4.) All mounting bolts installed and tightened (floor and wall). 5.) Mechanical alignments done. 6.) Control room cables properly dressed. 7.) All covers installed. 8.) Room cleaned. 9.) Product locator cards collected. 10.) Missing components and/or options: 11.) List of any installation drawing deviations (all deviations should be signed by customer). 12.) Packing materials disposed of. 13.) Dollies and crates returned: • Positioner Table / Standard Wall Stand dolly 14.) Have all calibrations been completed? 15.) Have the sample images been installed on the system? 16.) Have purchased options been installed/enabled/configured? 17.) Have System backup done? 18.) All appropriate regulatory labels installed: • Page 120 INSTALLATION MANUAL X-ray tube focal spot 19.) Have functional checks been completed? 20.) Are all covers installed? 21.) Have all protective tape/coverings been removed? 22.) Are there any cosmetic issues? 23.) Are there any system issues? 24.) Are there any functional limitations? 25.) Has system documentation (paper) been given to the customer? 26.) Has local physics inspection been completed? (some states/sites may not allow use of system for patients until this is done) 27.) Has backup of pristine system been performed? (Patient Data Base as well as total system backup) Section 5.0 - Cabinet Electrical Connections  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Item # 28.) INSTALLATION MANUAL Item Field engineer has completed all checklists: • Pre-Installation • Installation checklist Chapter 5 - - System Hardware Installation Page 121 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 122 Section 5.0 - Cabinet Electrical Connections  INSTALLATION MANUAL  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Chapter 6 System Configuration Section 1.0 When to Perform System Configuration Potential for Data Loss: 1.) Always create an up-to-date backup of your system data following product installation or changes to configuration data. 2.) Upon existing the Service User Interface (SUIF), for Configuration and Calibration information to take effect, the system must be reset. This must be done before the system is used for patient acquisitions. 1.1 During System Installation Your system is delivered to you configured with default values. You should configure your system to the values that are appropriate for your particular installation. The items that must be configured are identified in Step. Table 6-1 System Configuration Parameters System Configuration Parameter Step - Site Parameters on page 124 Step - General Parameters on page 125 Step - Positioner on page 126 Step - Product Network Filters on page 126 Step - HIPAA Configuration on page 127 Step - Generator Time on page 127 1.2 Missing or Lost System Backups If you perform a software install and do not restore configuration files, you must re-perform all of configurations listed in , after it’s complete. A software install resets all configuration data. If you performed a [backup] before you began the software install, you are not required to perform the configuration and calibrations. Simply [restore] the data saved previously 1.3 Addition of Purchased Options Installation of purchased options can only be performed by authorized GE sales and service representatives. If you add purchased options to your system, you should update the system configuration files immediately and create/save a new backup. Chapter 6 - System Configuration Page 123  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Section 2.0 Starting the System Configuration Tool 1.) Log into the System a.) Log in as username: insite b.) Enter the password. Note: Consult your Administrator for Password information. 2.) From the application desktop, click Utility-System-Service icon sequently. 3.) Click on [Launch] button. 4.) The Home page Summary information shall display. 5.) Click on Configuration icon. 6.) In the left frame, click on the page icon associated with the configuration parameter name you wish to change. Section 3.0 System Configuration Tool Parameters 3.1 Site Parameters The following information can be viewed regardless of service mode. All can be edited, except for those identified Table 6-2 Site Parameters Page 124 Parameters Definition Site Name Name of specific location (Hospital, clinic...) where system is installed (64 characters maximum) Street Address1 Address of location system is installed (5 lines, and 64 characters maximum per line) Street Address2 Address of location system is installed (5 lines, and 64 characters maximum per line) City City of system is installed (5 lines, and 64 characters maximum per line) State/Province State/Province of location system is installed (5 lines, and 64 characters maximum per line) PostalCode PostalCode of location system is installed (5 lines, and 64 characters maximum per line) Department Name Department name (i.e. Radiology) responsible for equipment maintenance (64 characters maximum) Telephone 64 characters maximum Fax 64 characters maximum Contact Person Name Customer or person responsible for maintenance of equipment. One line, and 64 characters maximum. Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-2 Site Parameters Parameters Definition Contact Person Phone Two lines, and 64 characters maximum per line System ID System identifier assigned by GE Healthcare following system installation and prior to customer turnover. (64 characters maximum) Installation Date Date system installation completed; created by GE Healthcare. (64 characters maximum) Service Contract Number* Customer licensed Inhouse Service Contract number; created by GE Healthcare. (64 characters maximum) Contract Expiration* Licensed Inhouse Service Contract number expiration date; created by GE Healthcare. (64 characters maximum) AE Title 16 characters maximum Port Number 4 characters maximum IP Address 16 characters maximum The system has occupied two network segments, that is “192.168.1.*” and “192.168.2.*”. Please avoid use the two network segments when setup the hospital IP address. 3.2 Subnet Mask 16 characters maximum Default Gateway 16 characters maximum Note: If the customer site does not have a default gateway, use the default value loaded upon installation. The field cannot be empty. General Parameters Table 6-3 General Parameters Parameter Definition Time Zone Allows the user to choose time zone according to site. System Clock Allows the user to set the system clock according to site needs. Data Display Format Allows the user to change/set system date display format. The Date format is defined as MM-DD-YYYY (default) or DD-MM-YYYY. Time Display Format Allows the user to change/set system time display format. The time Format may be kept in a 24 hour format (Military) or 12 hour AM/PM format: (hh:mm:ss (AM/PM)). The default value is Military KeyBoard Allows the user to change/set system KeyBoard type. Chapter 6 - System Configuration Page 125  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-3 General Parameters 3.3 Parameter Definition Measurement System Used to define English or Metric as the system’s measurement system. The default value is metric. Application Language Defines the language used for applications screens. The default value is English. For the site the chinese application wanted, the Chinese should be selected. Encoding Defines the language encoding. Encoding must consistent between system and the RIS/PACS/Printers. • ISO_IR 100:English encoding • GB18030:Chinese encoding • ISO_IR 192:Russian or other languages QAP Timeout This item determines the interval between QAP test in days. Used to inform system users that a QAP interval has expired and a QAP test should be performed. The default value is 7 days. VA Site This will configure the system for VA options. Screen Blank Timeout Used to set the period of inactivity (where no user inputs and processing activity occurs) in which screen blanking can begin. This feature functions to prolong the life of the monitor, thus preventing a burn-in. Time is selected in minutes. The default value is 15 minutes. (4 characters maximum) Image Mask Adjustment Adjusts the mask that is applied to the acquired image from the detector. It affect Raw and Processed images. Positioner Table 6-4 Positioner Parameter Parameter Meaning Mode choose the system work mode; normal work mode and exhibition mode Ceiling Height set height of the floor to the roof(unit: cm) Anti-Collision Yes:open the Anti-collision No: close the Anti-collision Motor Mode At Power On Speed:motor runs in constant-speed Power-assisted:manualoperation runs with the motor running 3.4 Product Network Filters Configure the Production network fiters,firewall default setting is ON. Page 126 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 3.5 CONFIGURATION HIPAA Configuration If you activate this function on Options parameter screen, upon system start-up, a Logon screen will pop up to protect your system data with entering an username and password. Please refer to System Login (HIPPA) on page 150 for operation steps. 3.6 Generator Time This test will execute the Jedi Time Diagnostics and Sync. Please refer to Jedi Time Sync with System Time on page 149 for operation steps. Section 4.0 Network Connection (DICOM) Configuration See the Operator’s Manual for instructions on how to configure DICOM on this system. The following worksheets should be used to capture and archive your system’s DICOM configuration for future reference. Records configuration information in the work sheets that follows. Place worksheets in a safe place so that they may be referenced in the future if needed. 4.1 Network Hosts 4.1.1 Host Tab Table 6-5 Host Tab Attribute Host Device 1 Host Device 2 Host Device 3 Host Label = = = Application Entry Title = = = Network Address = = = Port Number = = = Query Retrieve = = = Storage Commitment = = = Storage Commitment - Application Entity Title = = = Storage Commitment - Network Address = = = Storage Commitment - Port Number = = = Comments = = = Chapter 6 - System Configuration Page 127  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.1.2 CONFIGURATION Preference Tab Values for each network node are configured on the Workstation PC. Generally, options 1, 2 and 3 are enabled (checked) for remote viewing stations, PACS, etc. • Option 1 - Check this option if the remote host being configured should be able to Query and get a response of a list of images on the magic. • Option 2 - Check this option if the remote host being configured should be able to Retrieve any of images returned on the image list (pull) from the magic. • Option 3 - Check this option if the remote host being configured should be able to Send / Push any of the images in its local database to the magic. • Option 4 - This option will never be used since the magic does not yet generate multi-frame images. • Option 5 - Checking this option will cause the magic to strip out all patient information in the images being sent to the remote node being configured. Same as de-identify and push automatically. Some sites may want to check this option for some nodes being configured for security purposes (if they do not want to divulge any patient info to the folks using this remote node). • Options 6- should be checked / enabled based on the procedure that you have from Rich Warp. • Options 7 & 8 - will be used only for the HIS / RIS system being configured Option 7 should be selected for the HIS / RIS system only if it has been configured to accept MPPS messages from the magic. • Options 8 - may not be implemented on your system yet. If it has not been implemented, please ignore. • Options 9 - DX images send as CR Modality Table 6-6 Preference Tab Page 128 Option Attribute Value 1 Allow this network host to query the TERRA_NETWORK = 2 Allow this network host to retrieve from the TERRA_NETWORK = 3 Allow this network host to send images to the TERRA_NETWORK = 4 This network host accepts multiple frame image. = 5 Perform de-identification (anonymous patient images) when sending to this network host. = 6 Apply “Burn-On-Send” to images when sending to this network host. =Burn-On-Send 7 Send MPPS N-Create and N-Set notification to this network host. = 8 Make this network host the HIS/RIS source. (Only one host can be designated as the HIS/RIS source.) = 9 DX Images sent as CR Modality = Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2 CONFIGURATION Printers 4.2.1 Agfa Drystar 3000 Printer 4.2.1.1 Printer Parameters Table 6-7 Printer Tab Attribute Value Comments DICOM Printer Label DRYSTAR3000 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IPNetwork Address Enter value given by Site Network Administrator Port Number 104 Pixel Depth 12 Printer Pixel Size (micron) 79.4 Configuration Information PERCEPTION_LUT=LINEAR (no spaces) Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor 140 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Port number may be site specific, be sure to check on-site Not Supported Table 6-8 Layout Tab Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Not Applicable Chapter 6 - System Configuration Page 129  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-9 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = 2388 AGFA Layout - Portrait 9006 Pixel Height = 2972 10 x 12in Pixel Width = Pixel Height = 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = 3300 AGFA Layout -Portrait 9014 Pixel Height = 4256 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 4256 AGFA Layout -Portrait 2411 Pixel Height = 5174 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = General Comments: Note: 4.2.1.2 - Supports Clear and Blue Film. If medium selected (Clear, Paper) does not match the printer, the job will be queued until the correct film is loaded. - AGFA layouts are specific to maximum printable area layouts. Please consult the AGFA technical representative to install custom layouts - Only 14x17 film was tested with this printer. - Trim is not supported by this printer Avoid print job failures by having printer vendor ensure that the Confirmation Level (DICOM Connectivity) at the printer is set to ?? (accept all). Failure to set this level on the printer will result in failed print jobs Print Layouts For accurate image sizing, a custom layout must be configured by printer vendor/manufacture . In addition to the above layouts, the following layouts must be installed by the authorized AGFA print representative: Table 6-10 Agfa Drystar 3000 Print Layouts Page 130 FILM SIZE FORMAT P/L AGFA LAYOUT 14 x 17 1:1 P 2411 14 x 17 1:2 P 9001 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-10 Agfa Drystar 3000 Print Layouts 4.2.2 FILM SIZE FORMAT P/L AGFA LAYOUT 14 x 17 2:1 P 9000 14 x 17 2:2 P 9002 14 x 17 1:1 L 2511 14 x 17 1:2 L 9003 14 x 17 2:1 L 9004 14 x 17 2:2 L 9005 11 x 14 1:1 P 9014 11 x 14 1:2 P 9102 11 x 14 2:1 P 9103 11 x 14 2:2 P 9104 11 x 14 1:1 L 9018 11 x 14 1:2 L 9202 11 x 14 2:1 L 9203 11 x 14 2:2 L 9204 8 x 10 1:1 P 9006 8 x 10 1:2 P 9009 8 x 10 2:1 P 9008 8 x 10 2:2 P 9010 8 x 10 1:1 L 9007 8 x 10 1:2 L 9012 8 x 10 2:1 L 9011 8 x 10 2:2 L 9013 Agfa Drystar 5500 4.2.2.1 Printer Parameters Table 6-11 Printer Tab Attribute Value Comments DICOM Printer Label DRYSTAR5500 Or customers preference Chapter 6 - System Configuration Page 131  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Comments Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 104 Pixel Depth 12 Printer Pixel Size (micron) 55 Configuration Information LUT=0.0 Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor 140 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Not Supported Table 6-12 Layout Tab Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Not Applicable Table 6-13 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = 3852 AGFA Layout - Portrait 9006 Pixel Height = 4300 10 x 12in Pixel Width = 4880 Pixel Height = 5280 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = AGFA Layout -Portrait 9014 Pixel Height = Page 132 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Value Comments 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 6922 AGFA Layout -Portrait 2411 Pixel Height = 7788 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.2.2 Print Layouts For accurate image sizing, a custom layout must be configured by printer vendor/manufacture . In addition to the above layouts, the following layouts must be installed by the authorized AGFA print representative: Table 6-14 Agfa Drystar 5500 Print Layouts FILM SIZE FORMAT P/L AGFA LAYOUT 14 x 17 1:1 P 2411 14 x 17 1:2 P 9001 14 x 17 2:1 P 9000 14 x 17 2:2 P 9002 14 x 17 1:1 L 2511 14 x 17 1:2 L 9003 14 x 17 2:1 L 9004 14 x 17 2:2 L 9005 11 x 14 1:1 P 9014 11 x 14 1:2 P 9102 11 x 14 2:1 P 9103 11 x 14 2:2 P 9104 11 x 14 1:1 L 9018 11 x 14 1:2 L 9202 11 x 14 2:1 L 9203 11 x 14 2:2 L 9204 8 x 10 1:1 P 9006 Chapter 6 - System Configuration Page 133  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.3 CONFIGURATION FILM SIZE FORMAT P/L AGFA LAYOUT 8 x 10 1:2 P 9009 8 x 10 2:1 P 9008 8 x 10 2:2 P 9010 8 x 10 1:1 L 9007 8 x 10 1:2 L 9012 8 x 10 2:1 L 9011 8 x 10 2:2 L 9013 Fuji FM DPL Print Parameters Table 6-15 Printer Tab Attribute Value Comments DICOM Printer Label FUJIFMDPL Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 104 Pixel Depth 12 Printer Pixel Size (micron) 100 Configuration Information CS000 Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor SHARP Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Page 134 Not Supported Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-16 Layout Tab Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Not Applicable Table 6-17 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = 1998 Pixel Width = The following configurations must be configured by the Fuji printer representative to print correctly sized images: Pixel Height = • Pixel Width = LUT1 as SAR17 for calling AE_TITLE. • Trim width at 1 pixel for calling AE_TITLE. • Globally configure “a margin between image” for 0 pixels. • Globally configure “Image layout” for spread Pixel Height = 2510 10 x 12in 10 x 14in Pixel Height = 11 x 14in Pixel Width = 2540 Pixel Height = 3600 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 3500 Pixel Height = 4240 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.4 Fuji DryPix 1000 Print Parameters Table 6-18 Printer Tab Attribute Value Comments DICOM Printer Label DRYPIX1000 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 104 Chapter 6 - System Configuration Port numbers may be site specific, be sure to check on-site Page 135  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Attribute Value Pixel Depth 12 Printer Pixel Size (micron) 84.67 Configuration Information CS000 Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor SHARP Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 48Mbytes CONFIGURATION Comments Not Supported Table 6-19 Layout Tab Page 136 Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Not Applicable Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-20 film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = 2280 Pixel Width = The following configurations must be configured by the Fuji printer representative to print correctly sized images: Pixel Height = • LUT1 as SAR17 for calling AE_TITLE.-Trim width at 1 pixel for calling AE_TITLE. • Globally configure “a margin between image” for 0 pixels. • Globally configure “Image layout” for spread. • A densitometer filter (FUJI part number 605S0003) must be used when performing printer calibration. Pixel Height =2877 10 x 12in 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = 2962 Pixel Height = 4096 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = Pixel Height = 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.5 Fuji DryPix 3000 Print Parameters Table 6-21 Printer Tab Attribute Value Comments DICOM Printer Label DRYPIX3000 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 104 Pixel Depth 12 Printer Pixel Size (micron) 84.67 Configuration Information CS000 Density Min. = 20, Max. = 300 Magnification Type CUBIC Chapter 6 - System Configuration Port numbers may be site specific, be sure to check on-site Page 137  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Smooth Factor SHARP Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 48Mbytes Comments Not Supported Table 6-22 Layout Tab Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Not Applicable Table 6-23 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = Pixel Width = The following configurations must be configured by the Fuji printer representative to print correctly sized images: Pixel Height = • Pixel Width = LUT1 as SAR17 for calling AE_TITLE. • Trim width at 1 pixel for calling AE_TITLE. • Globally configure “a margin between image” for 0 pixels. • Globally configure “Image layout” for spread. • A densitometer filter (FUJI part number 605S0003) must be used when performing printer calibration. Pixel Height = 10 x 12in 10 x 14in Pixel Height = 11 x 14in Pixel Width = Pixel Height = 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 4072 Pixel Height = 4972 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = Note: Page 138 ONLY 14 x 17 film should be used with this printer. Any other film size used may print films with incorrect measurements Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.6 CONFIGURATION Fuji DryPix 7000 Printer Parameters Table 6-24 Printer Tab Attribute Value Comments DICOM Printer Label DRYPIX7000 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 104 Pixel Depth 12 Printer Pixel Size (micron) 50 Configuration Information CS000 Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor SHARP Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 48Mbytes Port numbers may be site specific, be sure to check on-site Not Supported Table 6-25 Layout Tab Attribute Value Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 Slide formats Chapter 6 - System Configuration Page 139  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-26 Film Size Tab Attribute Value Value 8 x 10in Pixel Width = 3907 Comments Pixel Height =4819 10 x 12in Pixel Width = Pixel Height = 10 x 14in Pixel Width = 5075 Pixel Height = 7043 11 x 14in Pixel Width = Pixel Height = 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = Pixel Height = 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.7 Kodak 8200 Print Parameters Table 6-27 Printer Tab Attribute Value Comments DICOM Printer Label KODAK8200 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 1024 Pixel Depth 12 Printer Pixel Size (micron) 78.15 Configuration Information LUT=Wkstn2a.w87,2 (no spaces) Density Min. = 20, Max. = 300 Magnification Type CUBIC Page 140 Port numbers may be site specific, be sure to check on-site Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Smooth Factor 15 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Comments Table 6-28 Layout Tab Attribute Value Comments Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 1:2 only valid for portrait 2:1 only valid for landscape Slide formats Not applicable Not supported: Do not select Table 6-29 film Size Tab Attribute Value Value 8 x 10in Pixel Width = Comments Pixel Height = 10 x 12in Pixel Width = Pixel Height = 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = Pixel Height = 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 3388 Pixel Height =4277 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = Chapter 6 - System Configuration Page 141  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.8 CONFIGURATION Kodak 8500 Print Parameters Table 6-30 Printer Tab Attribute Value Comments DICOM Printer Label KODAK8500 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 1024 Pixel Depth 12 Printer Pixel Size (micron) 78.15 Configuration Information LUT=Wkstn2a.w87,2 (no spaces) Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor 15 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Port numbers may be site specific, be sure to check on-site Table 6-31 Layout Tab Attribute Value Comments Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 1:2 only valid for portrait 2:1 only valid for landscape Slide formats Not applicable Not supported: Do not select Page 142 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-32 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = Pixel Height = The following configurations must be configured by the Kodak printer representative: Pixel Width = • Calling AE_TITLE must be declared in 9410 host table or print will be rejected. • Pixel correction turned off. • TFT emulation enabled. Landscape printing will be functional only if a Kodak 8800 is installed. 10 x 12in Pixel Height = 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = Pixel Height = 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width = 4096 Note: User will get incorrect image sizing if unsupported formats (i.e. portrait 2:1 or landscape 1:2) are used. Pixel Height = 5221 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.9 Kodak 8700 Print Parameters Table 6-33 Printer Tab Attribute Value Comments DICOM Printer Label KODAK8500 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 1024 Pixel Depth 12 Printer Pixel Size (micron) 78.1 Configuration Information LUT=Wkstn2a.w87,2 (no spaces) Density Min. = 20, Max. = 300 Magnification Type CUBIC Chapter 6 - System Configuration Port numbers may be site specific, be sure to check on-site Page 143  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Smooth Factor 15 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Comments Table 6-34 Layout Tab Attribute Value Comments Select the desired layouts allowed for this printer 1:1, 1:2, 2:1, 2:2 1:2 only valid for portrait 2:1 only valid for landscape Slide formats Not applicable Not supported: Do not select Table 6-35 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = Pixel Height = The following configurations must be configured by the Kodak printer representative: Pixel Width = • Calling AE_TITLE must be declared in 9410 host table or print will be rejected. • Pixel correction turned off. • TFT emulation enabled. Landscape printing will be functional only if a Kodak 8800 is installed. 10 x 12in Pixel Height = 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = Pixel Height = 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width=4096 Pixel Height =5221 24 x 24cm Pixel Width = Note: User will get incorrect image sizing if unsupported formats (i.e. portrait 2:1 or landscape 1:2) are used. Pixel Height = 24 x 30cm Pixel Width = Pixel Height = Page 144 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.10 CONFIGURATION Kodak 8900 Print Parameters Table 6-36 Printer Tab Attribute Value Comments DICOM Printer Label KODAK8900 Or customers preference Application Entry Title Enter value given by Site Network Administrator AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number 1024 Pixel Depth 12 Printer Pixel Size (micron) 38 Configuration Information LUT = Ver693c0.w87,6 Density Min. = 20, Max. = 300 Magnification Type CUBIC Smooth Factor 40 Trim NO Polarity NORMAL Border Density BLACK Empty Image Density BLACK Printer Memory Size 40Mbytes Port numbers may be site specific, be sure to check on-site Table 6-37 Layout Tab Attribute Value Select the desired layouts allowed for this printer Comments Check at least one (1on1) or more as desired Slide formats Chapter 6 - System Configuration Page 145  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Table 6-38 Film Size Tab Attribute Value Value 8 x 10in Pixel Width =4742 Comments Pixel Height =6286 10 x 12in Pixel Width = 6286 Pixel Height = 7342 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = 6712 Pixel Height = 8896 14 x 14in Pixel Width = 8896 Pixel Height = 8662 14 x 17in Pixel Width= 8896 Pixel Height =10612 24 x 24cm Pixel Width = Pixel Height = 24 x 30cm Pixel Width = Pixel Height = 4.2.11 Codonics Horizon Print Parameters Table 6-39 Printer Tab Attribute Value Comments DICOM Printer Label HORIZON Or customers preference Application Entry Title Enter value given by Site Network Administrator,eg : PRINT_SCP AE Titles may be site specific, be sure to check on-site IP Address Enter value given by Site Network Administrator Port Number Enter value given by Site Network Administrator, eg: 104 Pixel Depth 12 Printer Pixel Size (micron) 79.5 Configuration Information LUT = LINEAR Density Min. = 0, Max. = 300 Magnification Type Replicate Page 146 Port numbers may be site specific, be sure to check on-site Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION Attribute Value Comments Smooth Factor 0 Not supported Trim NO Polarity NORMAL Border Density BLACK Can also pass OD value of (0 - 310) Empty Image Density BLACK Can also pass OD value of (0 - 310) Printer Memory Size 40Mbytes Table 6-40 Layout Tab Attribute Value Comments Select the desired layouts allowed for this printer Slide formats Table 6-41 Film Size Tab Attribute Value Value Comments 8 x 10in Pixel Width = 2406 1.) Codonics Horizon printer supports Clear Film, Blue Film and Paper. Pixel Height = 2790 10 x 12in Pixel Width = 6286 Pixel Height = 7342 10 x 14in Pixel Width = Pixel Height = 11 x 14in Pixel Width = 3376 Pixel Height = 4072 14 x 14in Pixel Width = Pixel Height = 14 x 17in Pixel Width= 5322 Pixel Height =5025 24 x 24cm Pixel Width = 2.) Only 8 x 10 and 14 x 17 Film Formats have been validated 3.) Other Smoothing and Sharpening Algorithms for Magnification Type are supported. Consult CODONICS Technical representative to install custom preferences if desired. Pixel Height = 24 x 30cm Pixel Width = Pixel Height = Chapter 6 - System Configuration Page 147 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.3  CONFIGURATION Query Modality If FE wants to change query configuration, please select below “CR Modality” or “DX Modality” to set Modality in the System from UI. Section 5.0 Install Demo Images Load demo images from CD-ROM provided with the system into the image database. Refer to Operator’s Manual for procedure to upload images from CD. Section 6.0 Operator’s Manual (OM) Installation The operator manual must be installed and the appropriate language selected: - when the system is initially installed - following a complete system load from cold - following a software reload of the workstation PC The procedure follows: Note: Note: Page 148 - Reset the system to clear any inconsistencies. - Login the system: > Login as insite > Enter the Password Consult your Administrator for Password information. - Install the operator manual portable media in the host PC - Press the following keys: simultaneously, to open a command window. - Enter username. - Enter password. Consult your Administrator for Account and Password information. - Insert Operators manual CD into the CD bay of Workstation PC - To run the interactive script, at prompt type the following: ./xrdinstall.om Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Note: CONFIGURATION - Choose English as the language to install - Allow load process to complete. - Enter exit at the prompt. - To return to the graphical user interface, press keys simultaneously. - Remove the operator manual portable media from the host PC - Reset the system using the RCIM reset button - Login the system: > Login as insite > Enter the Password Consult your Administrator for Password information. - Launch the Image Management Viewer in Applications - Click on the Image Tools Button - Click on the Guide button Section 7.0 Jedi Time Sync with System Time 1.) Enter SUIF->Configuration->Generator Time. 2.) Follow the instruction, Click “Start” on the screen. Then “PASSED” result is displayed on the screen. Chapter 6 - System Configuration Page 149 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  CONFIGURATION Section 8.0 Adding a Bar Code Reader 8.1 Configuration A User’s Guide is supplied with the bar code reader for configuration. Please refer to the User’s Guide for additional programming choices. Make sure the correct keyboard is connected and configured before adding the Bar Code Reader Setting the bar code reader back to the default state will disable any user-programmed configurations, such as the addition of the tab character’ and first character stripping. Section 9.0 System Login (HIPPA) Note: 9.1 9.1.1 Usernames and passwords should only be created in conjunction with or in collaboration with the users system administrator. User Accounts System Log-in Upon system start-up, you must enter an username and password to enable the full functionality of the system. When the log in pop-up window is displayed, use the keyboard to enter your username and password. If you make a mistake, you will be notified to re-enter. You must be logged in as the insite user to configure the system. Once logged in, you will have full access to system features and operation you are entitled to by permissions. 9.1.2 About User Accounts Additional user accounts can be created to restrict access to system operation and data. Three account types are supported by this system: xruser, insite and root. When creating a user ID, you must choose one of these account types. xrusers- Users with these privileges are allowed access to all system features and operation. insite - Gives complete control over protocols and user accounts. The insite account includes all of the privileges defined for a typical Radiologist account. The difference is that the insite account can also create and maintain user accounts. root - Can only create user accounts. User accounts must be created after system installation or whenever system software is installed or re-installed. Page 150 Section 1.0 - When to Perform System Configuration  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 9.1.3 CONFIGURATION Default User Accounts When system software is installed, three “protected” user accounts are automatically created: xruser, insite and root. The user ID “xruser” is assigned Radiologist privileges. User ID “insite” is assigned Admin/Service privileges. These accounts cannot be deleted. Log into the Digital system with User ID insite, enter the password ******, for Admin/Service privileges. 9.2 Login Feature The login feature requires you to log in to gain access to the system and can be turned “on” or “off” by the system administrator. How your site uses this feature depends on if your site's policies. Sites with more than one network are referred to as Enterprise systems. Those without multiple networks are referred to as stand-alone systems. The login feature can be used withstand-alone or enterprise networks. Although some features are more applicable to enterprise systems. 9.2.1 Logging In and Out After a period of inactivity set by your administrator, a splash screen is displayed. • Logging In 1.) Type in your name and password. 2.) Click [Login] Note: Logging off does not prohibit other users from logging in. Logout is designed to protect patient privacy; not to stop approved users from logging in. When you or another user logs back in, the system returns to its last known state. • Emergency Login Your splash screen may or may not display the Emergency login button (2). Turning this option on or off is set by your system administrator. When using Emergency login, you may be prompted to enter your name. Use Emergency login unless you have a valid account set up. • log in with Admin Privileges If you have administrator privileges, when you log in you are asked if you to perform administrative tasks or scan. Do not click the button next to the Enter administrator screen, if you only want to scan. • Manual Logout 1.) Move the cursor to a blank area on the screen. 2.) Right-click and select Lock Screen from the menu. 9.2.2 Understanding users and groups Every person who has permission to use the system is a user. Users are set up by system administrators. These administrators may be IT personnel in an enterprise environment, or a site manager or lead tech in stand-alone environments. The administrator adds new users and assigns the users to a group which dictates the level of privileges a person will have. For example, a person named Sue Smith could belong to a group called technologists, radiologists, administrators, or any combination. 9.2.3 Understanding groups and privileges The group to which a person belongs has privileges. If you do not have an enterprise system, the assignment of group privileges will probably be limited to those who have administrator privileges Chapter 6 - System Configuration Page 151  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CONFIGURATION and those who don’t. If your system is set up for enterprise login, your IT person or administrator will be using more of the features. 9.3 Configuring the System System administrators can preform a number of tasks that affect what users can do or will see. please refer to the Chapter Login Administration in Operator Manual for this setup. Section 10.0 iLinq user guide Different workstation of Galaxy has different Modeltype. When OLE make Insite checkout, field engineer need first check workstation type, then tell them choose responsible Modeltype. Z400 workstation uses _GALAXY while Z440 workstation uses _GALAXYZ440. Wrong modeltype will make checkout failure. 1. Insure that insite Checkout is done successfully. Below icon will appear in the lower right corner of screen. 2. Click iLinq icon and open the iLinq web browser. 3. On the left frame list, the iLinq applications - ContactGE, Settings, Messages, TiP Virtual Assist could be accessed by clicking on the respective buttons. 4. In ContactGE, customer or FE could raises issues to GE OLE. Detail site information could be added in Settings and uploaded into GE OLE. Messages history could be checked in Messages. Tip Virtual Assist is a remote desktop tool which supply GE OLE an effective way to support and guide site customer or FE. 5. Click on the “TiP Virtual Assist” menu item in the Virtual Assist menu on iLinq browser. Then click on the Change Session Password button in the right window. Enter "testing" in the New Password and Confirm Password fields. 6. After password has been changed, click on Accept in the window. The Remote Training window pops up as shown directly below. 7. Please contact related GE OLE and wait for remote connection from GE OLE. Page 152 Section 10.0 - iLinq user guide GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  CALIBRATION Chapter 7System Installation Calibration Section 1.0 Before You Begin 1.1 Service User Interface (SUIF) A list of available system calibrations is displayed on the Service User Interface, whenever the calibration tab is chosen. Table 7-1 Service User Interface (SUIF) ICONs Clicking on the plus + to expand each folder. Click minus - sign to close a folder Open a calibration by clicking on the page icon. Be patient when executing commands. Text status messages are generally displayed in status line, whenever a calibration icon is selected. If you are uncertain whether a command is being executed, check the status line first. Repeated attempts to execute a command may require you to exit the SUIF and re-enter to gain control again. 1.2 Calibration Sequence Potential for Data Loss • Always create an up-to-date backup of your system data following product installation or after making any calibrations. • The system must be reset, upon exiting the Service User Interface for Configuration and Calibration information to take affect. This must be done before the system is used with patient acquisitions. Calibrations must be performed in the order shown on the left hand side of the calibration tab. The calibration summary screen only displays the date that a specific calibration was last performed. Chapter 7 - System Installation Calibration Page 153  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2.1 CALIBRATION After first installation, those calibrations are needed. Follow the steps below in. Table 7-2 First Installation Calibration Tool Calibration/Task Order Positioner Calibration U-Arm 1 Collimator Alignment Collimator 2 Tube Warm-up for Accuracy Tube 3 AEC Calibration Table Ion Chambor 4 Detector (Bad Pixels,Gain, CF) Calibration Detector 5 Dose Predication - mR/mAs Dose Prediction 6 Image Quality Printer 7 Quality Assurance Procedure (QAP) QAP 8 Generator Accuracy Test Spot check generator accuracy 9 You must always calibrate your system before it can be used and remember to restart your system after the calibration to active the calibration. 1.2.2 Saving Changes Do backup after calibrations in Chapter 11 - Software Instruction 1.2.3 Invoking New Calibrations Press the button on the Console to invoke calibration changes. The system must be rebooted if changes are made to calibrations files. This includes the creation of new calibrations and/or the restoration of calibration files. Applications software running on this system only reads calibration files during workstation boot-up. Any changes after boot-up are not detected by the applications software. 1.3 Returning the System to the User 1.) After completing calibrations, delete any New Patients files created during service, and before turning the system over to the end-user. 2.) Perform a system reset. A system reset must be performed to invoke changes. Application software and most SUIF tools only reads the system calibration files during boot-up. If you make changes, they will not be invoked until you reset (reboot) the system. 3.) Perform a system backup following calibration and after the system has reset. In order to preserve any new calibrations, a system backup must be made. Page 154 Section 1.0 - Before You Begin GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.4  CALIBRATION Temporarily Changing the Measurement System to Calibrations All positioner calibrations and functional checks use metric values (distances). If the applixations environment uses the English measurement system, the measurement system should be temporarily changed to Metric until the calibrations are completed. To change the Measurement System, open the Service Desktop and select Configuration/General/ Measurement System. Click on [English] or [Metric] to select. 1.5 OID) The use of Collimator(XS-1D) tape (Note the difference between SID and In the calibration, you need to use collimator tape to measure SID. In the case to measure SID, you need to consider the effect of OID (Object Image distance) . To measure the SID when Uarm is at the 90 degree postion, you can use the collimator tape to measure the distance from tube to patient and record it as length A. Then the SID = length A + OID. To measure the SID when Uarm is at the 0 degree postion, you can use the collimator tape to measure the distance from tube to table top and record it as length B. Then the SID = length B + Table OID. Section 2.0 Positioner Apply the instruction on the screen to perform the calibration Section 3.0 Tube Warm-up for Accuracy Use the below protocols before checking the Accuracy when a fresh Tube is connected to Jedi and Database is loaded for the first time. 3.1 REQUIREMENTS 1.) Use the focal spot of the tube specified in the table See Table 7-3, 2.) The operating tube voltage and current should be monitored all exposures during this operation. 3.) The anode rotation should be utilized at normal speed (3000 or 3600 min-1). 4.) Do not exceed either the generator or the tube ratings. ALL RADIATION SAFETY RULES MUST BE OBSERVED. IN ORDER TO PROTECT HUMANBODY FROM HARMFUL X-RAY, CLOSE THE COLLIMATOR OR BLOCK THE TUBE ASSEMBLY RADIATION PORT WITH AT LEAST A SIX (6) MM THICK PIECE OF LEAD. NO PATIENT OR PERSONNEL IS ALLOWED IN THE ROOM. Chapter 7 - System Installation Calibration Page 155  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 3.2 CALIBRATION Before you begin 1.) To check whether rotation function in Jedi is ready. 2.) To check whether ground function in Jedi is ready. 3.) To check whether high voltage receptacle is good. 4.) Close the collimator blade. 3.3 Tube Warm-up Procedure for Accuracy Step1: Open an exam, select fixed mode. Step2: Setup the exposure protocols as below one by one. Step3: Take required number of exposures for each protocol, wait for one minute between exposures. Step4: Close the exam. Table 7-3 Tube Warm-up Protocol for Accuracy Page 156 Filament Mode kV mA mS No. of Exposures SF 40 50 50 2 40 50 10 2 40 200 50 2 40 200 10 2 80 50 50 2 80 50 10 2 80 200 50 2 80 200 10 2 120 50 50 2 120 50 10 2 Section 1.0 - Before You Begin  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CALIBRATION Table 7-3 Tube Warm-up Protocol for Accuracy Filament Mode kV mA mS No. of Exposures LF 40 50 50 2 40 50 10 2 40 200 50 2 40 200 10 2 80 50 50 2 80 50 10 2 80 200 50 2 80 200 10 2 120 50 50 2 120 50 10 2 120 200 50 2 120 200 10 2 Section 4.0 AEC Calibration 4.1 Before You Begin The following applies when performing Automatic Exposure Control (AEC) calibrations. 4.2 • If additional information on a calibration is not shown below, just follow the instructions presented on SUIF. • Before executing any Automatic Exposure Control (AEC) calibration; if you have performed any positioner calibration you must reset the system by pressing the button on the console. Table Ion Chamber Calibrates the Ion chamber to produce the proper amount of output across all three Ion chamber cells. 4.2.1 4.2.2 Before You Begin • Flat Field Phantom required. • Grid Removed • Tube, generator and collimator shall be calibrated already. Procedure Follow the on-screen SUIF instructions as presented to finish AEC calibration. Chapter 7 - System Installation Calibration Page 157  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CALIBRATION Note: It is important that the Grid be removed before you start AEC calibration. If the grid is left in during calibration, the CF value will be higher than normal. The normal value for CF is approximately 1.2, whereas the value when the grid is left in is approximately 1.7. Note: FE shall strictly follow the steps to do AEC calibration, any wrong operation (including miss steps, wrong orders of steps or FE do any other additional operations) may cause calibration fail or some other mistakes in system. Section 5.0 Detector (Bad Pixels, Gain, CF) Calibration Mechanical risk. Be care of collimator collision. Remember to take flat panel phantom off from collimator before system power off or reset. 5.1 Before You Begin The following applies when performing Detector (Bad Pixels, Gain, CF) calibrations. 5.2 • If additional information on a calibration is not shown below, just follow the instructions presented on SUIF. • Remove the radiation meter from its case and allow it to warm-up to room temperature before using. • If the flat field phantom has any scratches, dents, or other imperfections on the large surfaces, it must be replaced before calibration. • The following tools are required: - Flat Field Phantom - Dose meter holder - Dosimeter (Keithley, MDH, or equivalent) • Bad pixel calibration must be executed before gain calibration is performed. • The system must be operating without a reboot for ten contiguous minutes or more. The detector requires ten minutes or more of stable operation before any calibration is performed. • When making exposures, hold the expose switch when requested for the entire specified amount of time. • If the SID, tube angle, or collimator rotation are not correct, an exposure will not be allowed. Calibration Overview There shall be 2 calibrations total for each kind of receptors and each calibration shall be consist of those those parts: • Bad Pixel Calibration - Used to detect defective pixels. It can be executed independent of the other calibrations but is not recommended. The BAD PIXEL calibration routine: • Page 158 - Acquires images without using X-rays for the first minutes - Automatically selects and locks default techniques - Manually sets the collimator blades to 45 cm x 45 cm size (slightly larger than the detector). - Displays the Initial Bad Pixel Calibration Screen (Dark Image processing). Gain Calibration - Tool is used to calibrate a gain coefficient for each pixel in order to achieve uniform gain across the detector. Run all kVp/Gain calibrations. Section 1.0 - Before You Begin GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Note: Do all the kVs in GAIN calibration procedure. Make sure that grid is taken out during detector calibration. • 5.3 5.4  CALIBRATION CF Measurement- Tool is used to update the CF and AEC dose calibration parameters. - Align the sensor of the Dose meter at the scale of 65cm on the ruler of the collimator - Run all CF measurement routines. - The measured exposure value must be entered in units of “mR"or “uGy" When should it be performed • During initial system installation. • Whenever a detector, X-ray tube, Beam quality filtration, Collimator or Ion chamber is replaced. • If the Ion chamber is re-calibrated. • When QAP has failed its isolated defect specification or QAP results have changed by more than 10% during a two week interval. • When a pixel or line artifact appears in an image(s). Procedure There are three steps for calibrating an Image Detector. All three steps must be completed in the following order: Bad Pixel Calibration, Pixel Gain Variation Calibration and CF Measurement. You are required to do the following: 1.) Follow the on-screen instructions as presented by the tool. 2.) Install the flat field phantom. 3.) Execute Bad Pixel Calibration refer to the screen instruction. 4.) Execute Gain Calibration refer to the screen instruction. - 20 mm flat field phantom must not be installed for the 60 kVp gain calibrations (gain >3000) - 20 mm flat field phantom must be installed for 80 and both 120 kVp (and gain >3000) 5.) Execute CF Calibration refer to the screen instruction. a.) Insert Flat Field Phantom into the X-ray Calibration Fixture. b.) Locate small chamber probe of Dosimeter between the collimator and the detector. Probe should be 65 cm from focal spot (measured by collimator tape). Note: The radiation meter is a very sensitive to temperature. It's important that the meter be at or near room temperature before making any measurements. The meter must be allowed to thermally stabilize for a minimum of 20 minutes after removing the meter from the case, especially if it has been stored outside. Important precautions follow: I.) If the meter is not stable and drifts with no exposure, let it stabilize before taking measurements. II.) Tape the meter in place to avoid misalignment during the measurement. III.) Verify that the Dose meter probe positioned properly. (eg: Keithley “Diagnostic side is facing the collimator.) IV.) Read the meter BEFORE touching the probe holder. Vibration of the meter will increase the exposure reading. V.) Hold the hand switch on prep for 3-5 seconds for each exposure. VI.) Verify that the aluminum is replaced in the collimator for the 2nd and 3rd exposures. Chapter 7 - System Installation Calibration Page 159  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CALIBRATION VII.)Verify the collimator size adjustments are not accidentally bumped when removing the probe holder. VIII.)Verify that the grid is not in place before proceeding. 6.) Configure Radiation meter to measure exposure in mR or uGy 7.) Execute CF Measurement Calibration. 8.) Perform QAP and verify that Image Quality (IQ) passes. Section 6.0 Dose Predication - mR/mAs The following applies when performing Dose Predication (mR/mAs) calibrations. • If additional information on a calibration is not shown below, just follow the instructions presented on SUIF. Before executing any Dose Predication (mR/mAs) calibration; if you have performed any positioner calibration you must reset the system by pressing the button on the Console. Section 7.0 Image Quality Calibration The following applies when performing Printer calibrations. If additional information on a calibration is not shown below, just follow the instructions presented on SUIF-Calibration-Image Quality-Printer. Section 8.0 Generator Accuracy Test Calibration The test provides a means to spot check generator accuracy in the field. you can execute the test at any step for disgnostic. If additional information on a calibration is not shown below, just follow the instructions presented on SUIF Section 9.0 Monitor Calibration Choose monitor calibration process according to workstation type, misuse will cause bad image quality. After system is powered on, please adjust the monitor follow below procedure. Page 160 Section 1.0 - Before You Begin  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • CALIBRATION BIGTIDE monitor Key function: Table 7-4 Keys Introduction Keys Situation Action Menu Always Jump to next line Up Slide controller Increase Value Command “Enter Key” Down Slide controller Decrease value Set Sub-menu Return to previous menu Table 7-5 Lock and Unlock OSD • Keys Action Press Set key, then press Up key 3 times within 3 seconds Lock or unlock OSD If workstation is HP Z400: 1.) Set BIGTIDE monitor in Menu option ( Left button on Monitor). 2.) In the Performance page, press the 2nd button to enter into this page, now you can adjust Brightness, the 2nd button is "+", the 3rd button is "-", please set Brightness as: 142. 3.) Press the 1st "Menu"button to enter into "Contrast" page, please set Contrast as: 100. 4.) Press the 1st "Menu"button to enter into "Backlight" page, please set Backlight as: 52. 5.) Press the 4th "Return" button to exit "performance" page. 6.) Press the 1st "Menu" until go to Service Level2, Press up, down, down to unlock service mode, press the 2nd "enter" button to enter LUT Settings, please set Gamma 2.2. 7.) Press the 4th "Return" button to exit "Service level2" page and Exit OSD Menu. • If workstation is HP Z440 Please be sure to connect PC with monitor by the 2 cables: DVI-D cable and DMS59 to DVI cable. 1.) If necessary, unlock the OSD. 2.) Press MENU Key to enter user OSD mode. 3.) Factory Reset: Press MENU key several times to go to Service Level2, Press UP Key one time, and DOWN Key two times within 3 seconds to enter user advance menu, then press MENU key to select Factory Preset, then press UP key 2 times to select and Proceed. 4.) Select LUT: DICOM: Press MENU key to go to LUT Settings then press UP key to enter, then press MENU key several times to go DICOM and press UP key to select. 5.) Exit OSD: Press SET key several times to go to Exit and then press UP key 2 times to exit OSD. 6.) Lock: Press Set key, and then press Up key 3 times within 3 seconds to lock OSD. Chapter 7 - System Installation Calibration Page 161  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CALIBRATION Section 10.0 PACS / Image Display Test Image 10.1 10.2 Objectives • Simplified Procedure: To determine configuration for Burn-on-Send or No-Burn for each destination host (PACS). • Results: To record results from Simplified Procedure and Additional Tests. • Background: To provide further information about Image Display on PACS. • Additional Tests: To test several Image Display characteristics (Optional). Simplified Procedure 1.) Verify All PACS Review Monitors Are Calibrated Note: Monitor calibration is a critical first step before testing and configuring Image Display. a.) Verify that the PACS monitor is calibrated according to DICOM Part 14. Each site is responsible for providing evidence of PACS monitor calibration. b.) View SMPTE Pattern I.) Load SMPTE pattern into Patient List by clicking on “Image Tools” then “SMPTE” II.) Send SMPTE pattern to PACS review workstation. III.) Verify that 5% and 95% squares are equally visible on PACS. c.) Record results in Table 7-7, line numbers 1 and 2. 2.) Send PACS Test Images to PACS a.) Load Images I.) Load the PACS Test Images onto the acquisition workstation. Either use: > DICOM-formatted CDROM with images > Images on system under Image Tools II.) Patient Name will appear as GE_PACS_Test_Image, Definium III.) Patient ID will be 1000001 b.) Configure PACS to [ No-Burn] I.) Click the Utilities icon II.) Click Network Connections – Edit III.) Select the Network Host for the PACS to be tested, click Edit IV.) Click the Preferences tab V.) Make sure that Apply Burn-on-Send to images… is not checked c.) Send No-Burn image I.) Highlight PACS Test Image #1 in the Images list Note: All images in the GE_DX_Image_Display_Test exam are named "1". In the following steps, when an Image number (1, 2, 3....) is called out, you should select that image ’position’ from the Images list. For example: image number 1 is the first image on the list, image 6 is the sixth image on the list. To verify that you have selected the correct image, the image number can be viewed in the upper left corner of the image. II.) Click the appropriate PACS Network Host in the Destination icon list d.) Configure PACS to Burn-on-Send I.) Click the Utilities icon, click Network Connections – Edit II.) Select the Network Host for the PACS to be tested, click Edit Page 162 Section 1.0 - Before You Begin  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 CALIBRATION III.) Click the Preferences tab; check the option Apply Burn-on-Send to images… e.) Send Burn-on-Send image I.) Highlight PACS Test Image 6 in the Images list II.) Click the appropriate PACS Network Host in the Destination icon list f.) Review images on PACS I.) Bring PACS Test Images 1 and 6 up on the PACS review workstation. > The images can be identified by the watermark image number next to the GE logo inside the chest image region. > Verify (if possible) that Image 1 is displayed with a VOI-LUT, and Image #6 is displayed with a Linear LUT II.) If PACS Test Images 1 and 6 appear visually identical (equal number of bright/dark bands), the PACS supports VOI-LUT. **: Configure PACS as No-Burn III.) If PACS Test Images 1 and 6 appear visually different (different number of bright/dark bands), or chest region has saturation in lung or abdomen, the PACS either does not support VOI-LU or applies it incorrectly. **: Configure PACS as Burn-on-Send IV.) Record results in Table 7-7, line numbers 3 and 4 ** For more information, see Background and In-Depth Instructions below. 3.) Suggested Configurations Table 7-6 should be used as a guideline in addition to the tests above to determine if a PACS system should be configured for Burn-on-Send. This table considers only whether a PACS supports VOI-LUTs. Table 7-6 Suggested PACS Configurations No-Burn Burn-on-Send GE Centricity RA1000 v1.0,v2.0, v2.1 GE Pathspeed v7.12, 8.0 GE Centricity RA600 v6.1, 7.0 GE AW v3.1, 4.0 GE Radworks v5.1 Kodak DirectView v4.3 GE Pathspeed v8.1 or later Kodak DirectView v5.1, 5.2 McKesson HRS v3.3, 3.3.2 Kodak Directview(CEMAX ICON), v4.3 Fuji Synapse v3.0, 3.1 Merge eFilm, v2.0, 2.1.0 Agfa IMPAX v4.5, 5.2 Stentor iSite v3.0, v3.3.1 Philips Siemens Magic View 300 RealTime iPACS Viewer v5.0 VA Vista GE-IDX-RealTime iPACS Viewer v5.0 Picker Philips EasyAccess Neusoft v3.0 Sectra v10.2 Thinking Systems ----- AMICAS LightView v4.10.196 Chapter 7 - System Installation Calibration Page 163  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 10.3 CALIBRATION Results Table 7-7 Results from the Simplified and Additional Tests Sections Category Number Tests 1 PACS monitors calibrated according to DICOM 2 SMPTE 5% and 95% squares equally visible on PACS? 3 Images 1 and 6 appear visually identical? 4 PACS configured for Burn-on-Send? Simplified Yes / No WC = / / 5 DICOM Header on PACS (Image 1 No-Burn)? WW = / / VOI-LUT Tags(Yes/No WC = / / 6 Additional Tests DICOM Header on PACS (Image 6 Burn-onSend)? 7 Values Displayed on PACS Viewer (Image 1)? 8 Values Displayed on PACS Viewer (Image 6)? 9 Saturation visible in Lung or Abdomen region? 10 Able to see all five squares in Top Band of Image 6? 11 Able to see all five squares in Top Band of Image 1? 12 Images 1, 4 and 5 appear visually identical? 13 Images 6, 7 and 8 appear visually identical? 14 PACS able to select Normal/Harder/Softer? 15 DICOM Header on PACS (Image 9 - CRFallback)? VOI-LUT not present; correct WW/WC? Page 164 Section 1.0 - Before You Begin WW = / / VOI-LUT Tags(Yes/No WC = / / WW = / / WC = / / WW = / / NO GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  CALIBRATION Section 11.0 Quality Assurance Procedure (QAP) Mechanical risk. Be care of collimator collision. Remember to take flat panel phantom off from collimator befor system power off or reset. 11.1 Before You Begin The following applies when performing Quality Assurance Procedure (QAP). 11.2 • If additional information on a calibration is not shown below, just follow the instructions presented on SUIF • Before executing any Quality Assurance Procedure; if you have performed any positioner calibration you must reset the system by pressing the button on the RCIM When to Perform QAP Perform QAP every time you calibrate the detector (Wall Stand ) and as a final system check following system installation. See the Operators Manual for the QAP procedure 11.3 Simplified Procedures 1.) Click [Image Quality] button Figure 7-1 Image Quality button 2.) Click [Quality Control Tools] and [Acquisition] sequently to open QAP screen. Figure 7-2 Open QAP screen 3.) Perform QAP under the screen instruction Chapter 7 - System Installation Calibration Page 165  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 166 CALIBRATION Section 1.0 - Before You Begin  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AFTER INSTALLATION Chapter 8System Check Section 1.0 Operational Checks This section is used to perform the check the mechanical movement. 1.1 1.2 1.3 U-Arm Longitudinal Movement • Pressing the Up/Down movement button moving the U-Arm Check the longitudinal movement is operating smoothly and uniformly • Release the button, check the housing is locked. Positioner SID Adjustment • Pressing the SID movement button moving the detector housing and tube component. The positioner shall have a SID range from 1000mm to 1800mm. • Release the button, check the housing is locked. Tube Rotation Release the lock and hold the operation handle to drive the tube component to the left or to the right for rotation. Check the Tube component can be rotated not less than +45 degree~ -240 degrees. 1.4 Detector Housing Rotation Release the lock and hold the operation handle to drive the tube component to the left or to the right for rotation. Check the Tube component can be rotated not less than +45 degree~ -45 degrees. 1.5 Collimator Rotation 1.) Loosen set screw. 2.) Rotate the collimator. 3.) Check the collimator can be rotated. 4.) Secure set screw 1.6 Grid Insert 1.) Power on the system 2.) Enter to the exposure screen 3.) Insert the grid to touch the grid switch and see whether the status of grid is displayed as “IN” in exposure screen. Then, take out the grid to see whether the display is changed to “OUT” Chapter 8 - System Check Page 167  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AFTER INSTALLATION Section 2.0 Functional Checks 2.1 Image quality test 1.) Go to SUIF according to the instruction described above. Then press the “Image Quality” button on the SUIF. 2.) Then press "Image control tools" to do the QAP. There will be the detail instruction on the screen for each step. The system will tell operator the pass or failed. 3.) Wait until the test result displayed. Make sure all the items pass the test. 2.2 Image artifact check (Optional) Please follow below steps to check if there any image artifact may impact clinical diagnostics. 1.) Set exposure mode and technique as: Digital cassette receptor; SF; 80kV; 200mA; Detector position, SID and FOV same as Digital cassette calibration setup. Insert 20mm Aluminum phantom (5270546) into the tray on collimator. 2.) Set exposure time to 5ms, and take exposure. After exposure is done, view Raw Image to adjust contrast to 98% and set brightness to visible level. Zoom the image to 1, pan cross the whole image to observe the image to make sure there is not any visible artifact. 3.) Set exposure time to 32ms, and take exposure. After exposure is done, view Raw Image to adjust contrast to 98% and set brightness to visible level. Zoom the image to 1, pan cross the whole image to observe the image to make sure there is not any visible artifact. 4.) Set exposure time to 80ms, and take exposure. After exposure is done, view Raw Image to adjust contrast to 98% and set brightness to visible level. Zoom the image to 1, pan cross the whole image to observe the image to make sure there is not any visible artifact. The detector calibration can be passed if this check is ok. Otherwise, it needs to redo detector calibration or mark the bad line. 2.3 Acqisition Test Create a new patient. Select “chest” exam, AEC mode. Insert detector into detector housing. Align the tube to detector. Open a suitable FOV. Check if there no exposure inhibit displayed. Press hand switch do an exposure. Close the exam. Page 168 Section 2.0 - Functional Checks  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AFTER INSTALLATION Chapter 9 - Labels and Rating Plates Product identification labels can be found on the tops and sides of the cabinets, the rear of monitors, and other exterior surfaces on the equipment. The types of system identification compliance plates or labels are located in below table. Some additional labels needed to attach in fields will be included in accessory box. Contact service personnel if you can not find them. Section 1.0 Labels to Attach in Field • The System Rating Plate, U-Arm Rating Plate, PDU Rating Plate, Table Rating Plate and Console Rating plate in multi-languages are packaged with equipment, please select the right one to paste under the instruction in Section 2.0 according to the local regulatory requirement. • Warning label on console in multi-languages are packaged with equipment, please paste the right one according to the local regulatory requirement. • Special Indonesian label for Indonesia Paste the label to the back of the column • Special IECV3 label Paste the label to the right side of the table rating plate Chapter 9 - - Labels and Rating Plates Page 169  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • AFTER INSTALLATION Caution label on PDU The caution label on PDU in multi-languages are packaged with the equipment. Please select the right one according to the local regulatory requirement and paste it beside the original one. Page 170 Section 1.0 - Labels to Attach in Field  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AFTER INSTALLATION Section 2.0 Rating Plate PRODUCT OR COMPONENTS RATING PLATES LOCATION System Note: The local language Rating Plate would possibly required to paste in fields. Please select the right one from the package. Table Note: The local language Rating Plate would possibly required to paste in fields. Please select the right one from the package. Chapter 9 - - Labels and Rating Plates Page 171  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 PRODUCT OR COMPONENTS AFTER INSTALLATION RATING PLATES PDU Note: The local language Rating Plate would possibly required to paste in fields. Please select the right one from the package. U-Arm Note: The local language Rating Plate would possibly required to paste in fields. Please select the right one from the package. Page 172 Section 2.0 - Rating Plate LOCATION  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 PRODUCT OR COMPONENTS RATING PLATES AFTER INSTALLATION LOCATION Console Note: The local language Rating Plate would possibly required to paste in fields. Please select the right one from the package. Detector Tube collimato r (XS1D) Chapter 9 - - Labels and Rating Plates Page 173  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 174 AFTER INSTALLATION Section 2.0 - Rating Plate  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 AFTER INSTALLATION Chapter 10Final Admin Job 1.) Ready system for normal customer operation. 2.) Install all covers on system equipment. (Refer to above for procedure.) 3.) Remove trash, remove installation equipment and tools, clean up room and store service manuals. 4.) Fill out and return the Product Locator Cards or complete in eGIB. 5.) Record installation time in Service database. Chapter 10 - Final Admin Job Page 175  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 176 AFTER INSTALLATION Section 2.0 - Rating Plate  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT Chapter 11 Software Instruction Section 1.0System Data Backup and Restore Potential for Data Loss. Archive all protocols, patient files, and backup calibration and configuration data. It's recommended that a system backup be performed prior to any installation, upgrade or restoration of software. The installation of software can destroy existing files, including patient, calibration and configuration files. You might have to configure and calibrate your system, if you do not have a good backup to restore! Purpose: Files within the workstation PC and other subsystems need to be saved, if system software is reload, upgraded or becomes corrupt. After system installation or in the event a subsystem failure occurs, saved files can be restored in their original condition and location. 1.1 System Backup’s Coverage The following data is part of a system backup: 1.) All Calibration Files 2.) All Configuration Files. 3.) System Error Log 4.) Image Quality Results 5.) Custom Looks 6.) DICOM Printers/Preferences/Network Configurations. HPZ400 and HPZ440 has different OS, so OS configuration of backup CD can’t be restored into workstation of different OS system, or system will crash. Chapter 11 - Software Instruction Page 177 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT If the old PC HPZ400 is replaced to new PC HPZ440, DO NOT perform restore OS configurations of old Z400 backup CD into new Z440 system. Need manually perform below steps. The following data need to backup by taking photos of their configuration page. • SUIF > Configuration 1.) PNF:ON/OFF 2.) NTP setting 3.) Site parameters: IP Address/Subnet Mask/Default Gateway • System Utilities screen > Network Connections - RIS/PACS/Printer settings The system login username/password setting can't be restored by old backup CD when you replace the old PC 5810000-A to new PC 8770000-11 at first time. So, please don’t forget to create new ones manually under customer’s requirement after the configuration is restored by old backup CD. You may create it through below operator screen. - System Utilities page > Preferences page > Login Management page The following data is not included in a system backup: 1.) Archival of Image Data - The process for archiving image data is found in the operators manual. 2.) Procedure Protocols - You only need to save the protocol data base (dBase) if you have made changes to the default values. Defaults are always loaded during an SW installation. The default protocol dBase is included with each system shipped. See the operators manual for procedures. The Repeat Reject Analysis Data will not be saved with the System backup. Use the RRA Reporting Tool to export Repeat Reject Analysis Data if desired. 1.2 1.2.1 Backup Before You Begin The backup utility is used to create a copy of system files, which are stored in various places (subsystems and directories). 1.2.2 - Workstation PC - Generator (Jedi) Procedure1 1.) From the application desktop, click on the Service Tools icon. 2.) Click on [Launch] button. 1. Page 178 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 3.) Select the Utilities Tab. 4.) Click on the plus sign preceding the System folder ICON, in the navigation frame. 5.) Click on Backup link. 6.) Insert your “Backup” CD into the CD/DVD drive. 7.) Select the media type by clicking on one of the media type buttons. 8.) Click on [START]. - Note: To cancel and return to the Tools main screen, press [STOP] USB Backup cannot be stopped and do not remove USB drive during Backup. 9.) When backup is complete, you will see “System backup success" in the status bar. 10.) Remove and label CD((include current date and time)). 11.) Exit SUIF 1.3 1.3.1 Restore Before You Begin • After the OS Configuration restore is run, the SUIF will no longer respond because of the files that have been changed. A system Reset must be performed after restoring the OS Configuration files to continue using the SUIF. • Only one selection can be restored by execution of the following procedure. The following procedure must be repeated for each item you wish to restore. There are seven system items available to be restored. You must perform the procedure for each item to completely restore all of the system’s files (calibration & configuration) Available choices are: - Digital - IUI - System Control Chapter 11 - Software Instruction Page 179 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 - IP Looks - Table IDC - ASTRA - OS Configuration  SOFTWARE INSTALLATIONT OS Configuration can't be restored to new PC 8770000-11 by the backup CD which is performed on the old PC 5810000-A • You must have a “good” backup of the files you wish to restore from CD or USB. The data in system backup/restore CD contains related OS config file. HPZ400 and HPZ440 has different OS, so OS configuration of backup CD can’t be restored into workstation of different OS system, or system will crash. If the old PC HPZ400 is replaced to new PC HPZ440, DO NOT perform restore OS configurations of old Z400 backup CD into new Z440 system. Need manually perform below steps. You should have recorded the original settings by photos when you perform data backup for them before. • SUIF > Configuration 1.) PNF:ON/OFF 2.) NTP setting 3.) Site parameters: IP Address/Subnet Mask/Default Gateway • System Utilities screen > Network Connections - • System Utilities screen > Preferences > Login Management - 1.3.2 RIS/PACS/Printer settings To create a special username/password for costumer manually. Procedure Potential for Data Loss. DICOM configuration information is not part of the backup. All DICOM information should be kept written down and kept with system information. Use it later to manually reconfigure DICOM, after the restore is completed. If the OS configuration restore needed, please do it at last step. 1.) From the application desktop, click on the Service Tools icon. 2.) Click on [Launch] button. Page 180 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 3.) Select the Utilities Tab. 4.) Click on the plus sign preceding the System folder ICON, in the navigation frame. 5.) Click on Restore link, 6.) Select the media type by clicking on one of the media type buttons. 7.) Click on [START]. - To cancel and return to the Tools main screen, press [CANCEL] 8.) Click on the down-arrow in the drop down box to display a drop down list of items. 9.) Click on the item you wish to restore. 10.) Insert your “Backup” CD into the CD/DVD drive. 11.) Click on [CONTINUE] to restore the selected subsystem. To cancel subsystem restore, press Chapter 11 - Software Instruction Page 181 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT [CANCEL] . 12.) When restore is complete, you will see restore success in the status bar. 13.) Exit SUIF 14.) Reset the system Section 2.0 System Software Load and/or Upgrade Note: 2.1 2.2 Configure the Time Zone after software re-installation or upgrade. Personnel Requirements • Required Persons: 1 person • Preliminary Reqs: 5mins • Procedure: 75 (Time estimate does not include saving and restoring patient images and/or protocols files) • Finalization: 0 min Overview Before You Begin: • The following times are typical for a complete system LFC: 1.) Five Minutes to backup system files. 2.) Approximately ninety minutes to save and restore images and protocols. 3.) Thirty minutes to install the OS and Applications software. 4.) Thirty Minutes to load generator software 5.) Five Minutes to restore system files. 6.) Five minutes to cleanup and return system to operational readiness. • Only use this System Software load procedure to re-install and/or upgrade your system software completely. The following procedure installs both the operating system, application and Generator software. • Pay particular attention, if instructed, to system resets. It's important that power be cycled according to a specified procedure. Cycling power at the wrong time or by the wrong method can result in a PC's operating file system (Linux) becoming corrupt. If the OS on the PC gets corrupted, you may have to reload it again or start over. • What happens when you press and hold the button on the Console? In less than one minute, the system cycles all subsystem power “OFF” and then “ON” again: 1.) When the reset button is pressed, the console sends a signal to the I/O board (Corona) to cycle (reset) system power. 2.) The I/O board then notifies software running on the PC that a shutdown is about to begin. 3.) Software on the PC begins an immediate and orderly shutdown of software on the PC. 4.) When 40 seconds has expired, the I/O board sends a command to shutoff all subsystem power to the PDU. 5.) Within ten seconds after all subsystem power is shut-off, the I/O board turns “ON” all subsystem power again. 6.) The PC then reboots and the system returns to operational readiness. Page 182 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • Note: 2.3 SOFTWARE INSTALLATIONT The following SW procedure assumes that you are beginning with the System powered “ON” and application software running (i.e. System Operationally Ready). Configure the Time Zone after software re-installation or upgrade by refer to Planned Maintenances. Preliminary Requirements 2.3.1 2.3.2 Tools and Test Equipment • Linux Operating System Software DVD: 1 • System Applications Software CD-ROM: 1 Consumables • 2.3.3 Empty/blank CD-R: 2 Safety Potential for Data Loss. 2.3.4 2.4 • Archive patient images you wish to keep. • Backup protocols you wish to keep. • Preform a “Save” of system configuration and calibrations data and label the CD-R. • Do not press the button on the Console, Unless you are instructed. Required Conditions • System must be 100% functional and operationally ready before performing the following procedure. • Suggest you unplug the ethernet cable before you begin. Procedure 1.) Are you performing a new system installation? a.) Yes; start the procedure at Step 4. b.) No; continue on to the next step (Backup System Files). 2.) Backup System Files. Refer to 1.2-Procedure on page 178 3.) Backup Protocol Data Base and System Images. a.) Save Protocol Data Base. Note: From SUIF/Config/General/Application Language, record the language config. This is because the database only can be restored at the system configured with the same language environment. I.) From the Worklist screen, click Service Tools icon. The Service Tools screen appears. II.) Select Preferences first and then Protocols, from the menu. III.) Insert a blank CD into the CD tray and close. Chapter 11 - Software Instruction Page 183 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT IV.) Click [Back up] . V.) A message will appear: Press OK to continue with Protocol Database back up. VI.) Press [OK] after you see the message. The protocol database is saved to the CDRW. VII.)Remove the CD from tray and label it as “Protocol Database” (include the current date and time). VIII.)Place the CD in safe location for future use. b.) Save Images I.) Open the CD tray. II.) Insert your blank CD-R into the tray. III.) entering the Worklist screen and clicking the icon of image management,this is shown in following picture. Page 184 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT IV.) Now, select the exams you wish to copy. Note: select some exams with CTRL+LEFT BUTTON V.) Click on [CD1] on the lower left corner of the screen as the destination. The CD Write screen will appear with the following options: • Deselect All - Deselects all exams on the list. • Store Optimally - Automatically checks if the selected images will fit on the CD. It will automatically deselect any items that cannot fit onto the CD. • Write - Begins the copy process. • Cancel - Closes the screen and returns you to the Image Management screen. VI.) Confirm that the exams to be copied are the ones you have chosen. Deselect any exams you do not want saved to the CD-RW. VII.)Click on [Write], using the mouse. 1.) The CD begins copying. 2.) To see the status of the exams being copied, click on located at the bottom of the Image Management screen. 3.) The transfer log screen will appear. 4.) Click on [Close] and return to the Image Management screen. 5.) When copying is complete, the CD tray will open. VIII.)Remove the CD from tray and label as Image Data (include current date and time). 4.) Perform the “Load from Cold”. Before performing the next detailed System Software "Load from Cold" procedures, please check the PC model is HPZ400 or HPZ440 at first. The procedures of them will be different. Do not press the RESET button on the Console, unless you are instructed to. Chapter 11 - Software Instruction Page 185 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 •  SOFTWARE INSTALLATIONT If the PC is HP Z400: a.) Load Linux Operating System (OS) software. I.) Place the Linux Operating System DVD into the PC. II.) Press and hold the RESET button for at least 3 seconds. You will hear a short beep, and the system will begin to shut down and later reboot. III.) When a ring is heard,the PC “splash” screen is displayed, press as instructed on the screen. IV.) When the Boot Device Menu is displayed, select to boot from "Optical Drive" and press the key. V.) When the "Boot: "appears, type: GEHCXR and then press the key. VI.) Be patient, it takes approximately 15 minutes for the Linux Operating System software to load. VII.)Remove the Linux Operating System DVD from the PC and close the CD/DVD drive drawer. b.) Load Application Software I.) Insert the Applications CD into the CD/DVD drive. II.) Open the CDROM, and run the "autorun" file once. It will reboot for installing the Graphics driver. III.) After entering the system, open the CDROM and run the "autorun" file again. IV.) Select “Brivo XR575” for Brivo XR575 model or "Brivo XR515" for Brivo XR515 model as the product configuration to install Software. V.) Click the Install tab. VI.) When the installation of applications software is complete, "Installation is complete" appear on the screen. VII.)Click OK. VIII.)Click [REBOOT] IX.) The system will reboot and pop up the login screen. X.) Remove the Applications CD from the CD/DVD drive. • If the PC is HP Z440: a.) Load Linux Operating System (OS) software. I.) Place the Linux Operating System DVD into the PC. II.) Press and hold the RESET button for at least 3 seconds. You will hear a short beep, and the system will begin to shut down and later reboot. III.) When a ring is heard,the PC “splash” screen is displayed. And then in the welcome Page 186 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT window of Linux OS, choose “GEHC X-ray” and press . IV.) Then choose “XR Default Configuration” and press in the “X-ray configurations” window. V.) Be patient, it takes approximately 30 minutes for the Linux Operating System software to load. Chapter 11 - Software Instruction Page 187 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Note:  SOFTWARE INSTALLATIONT with a brand new hard disk, you will see this dialog before Linux OS starts to load. Choose “Yes, discard any data” button to continue. VI.) click “Reboot” when Linux OS complete installation. VII.)Remove the Linux Operating System DVD from the PC and close the CD/DVD drive drawer. b.) Load Application Software I.) Insert the Applications CD into the CD/DVD drive. II.) Open the CDROM, and click the "autorun" file. Then click the button “Run in Terminal” in the popup window. III.) Select “Brivo XR575” for Brivo XR575 model or "Brivo XR515" for Brivo XR515 model as the product configuration to install Software. Page 188 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT IV.) Click the Install button. V.) When the installation of applications software is complete, "Installation is complete" appear on the screen. VI.) Click OK. VII.)Click [REBOOT] VIII.)The system will reboot and pop up the login screen. IX.) Remove the Applications CD from the CD/DVD drive. Chapter 11 - Software Instruction Page 189  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 5.) If need, refer to Galaxy Change IP Instruction as below. For Brivo XR575 system, 192.168.2.1 and 192.168.2.45 has been used by Magic PC eth1 and Detector. The system also has occupied two network segments, that is “192.168.1.*” and “192.168.2.*. If these IP addresses also used in hospital network, we need to change Magic PC eth1 and Detector IP. So, if system IP conflict with these IPs, please follow the below procedure. Galaxy Change IP Instruction 1. Login My Workshop and search DOC1931860. Download changeIP script according to Galaxy workstation type. If workstation type is Z400, please download script changeIpZ400; If workstation type is Z440, please download script changeIpZ440; Warning: if running wrong configuration of changIp script, system application software will crash and need reinstall OS/APP. 2. Burn the script to empty CD or copy it into usbdisk. Note: Please copy the script without any folder. 3. Press Ctrl+Shift+F5 to engage the EngGUI window, click the icon of command terminal to popup a command prompt window. 4. Type /sbin/ifconfig, check eth1 IP address. The IP address of eth1 is 192.168.2.1 Page 190 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 5. Put CD with script changeIp into the CDROM of workstation. Or insert usbdisk with script into workstation. Please follow steps 5.1-5.3 5.1 If using CD, type mount /mnt/cdrom then press enter; If using usbdisk, ignore this step. 5.2 if using CD, type cd /mnt/cdrom then press enter; If using usbdick, type cd /mnt/usbdisk then press enter. 5.3 Type ls then press enter, you can see the changeIP script in the folder. 6. In the terminal window, login: su Password: Consult your Administrator for password information 7. Copy the script into harddisk. if workstation is Z400, type cp changeIpZ400 /magichome/xruser/engg/ then press enter; if workstation is Z440, type cp changeIpZ440 /magichome/xruser/engg/ then press enter. 8. Type cd /magichome/xruser/engg then press enter. 9. if workstation is Z400, type ./changIpZ400 and then press enter to execute the application; if workstation is Z440, type ./changIpZ440 and then press enter to execute the application. 10. Input related number to choose the IP which do not conflict with the hospital network, for example 1. Then press enter and wait the system auto reboot done. Chapter 11 - Software Instruction Page 191 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT 11. After system reboot completes, login to system. run /sbin/ifconfig to check the eth1 IP is changed successfully. 12. Verify that detector could boot successfully and you can take an exposure successfully. NOTE: While after change IP, pls redo the system backup. While the SITE do the LFC , we need run the ChangeIP script again just after the LFC then do the restore . Pls pay attention to the order and detector will not boot if do not follow the correct order. 6.) Login to System Note: Username and password are case sensitive. Enter them carefully. a.) Enter username. Username:insite b.) Enter password. Password:Consult your Administrator for Password information. 7.) Create User Accounts (Not Required if you have a System Calibration/Configuration Backup CD) Enter hospital user names and passwords, if they do not already exist on a system back CD. 8.) Are you performing a new system installation? a.) Yes, skip to Step 14 b.) No, proceed onto “Selectively Restore System Calibration and Configuration Files” Step 8 9.) Selectively (except Generator dB) Restore System Calibration and Configuration Files. Note: Do not restore the Generator dB files at this time. You will restore that file after the generator software is loaded. a.) From the Application Desktop, click on the Service Tools icon. b.) Click on the [Launch] button. c.) Page 192 Select the Utilities Tab. Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT d.) Click on the plus (+) sign preceding the System folder icon in the navigation frame. e.) Click on the [ Restore] link. f.) Insert your “Cal/Config Backup” CD or USB. g.) Select the media type by clicking on one of the media type buttons. h.) Click on [START]. * To cancel and return to the Tools main screen, press [STOP] i.) Click on the arrow that points down, in the drop-down box, to display a list of items that can be selected. j.) Restore the Digital files k.) Restore OS Configuration files Chapter 11 - Software Instruction Page 193  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 l.) SOFTWARE INSTALLATIONT Remove Cal/Config Backup CD. m.) Press and hold the RESET button for 3 seconds. You will hear a short beep. You will now re-initialize the system to recognize the restored calibration and configuration files n.) Log into the system, when prompted. o.) Open the Service Desktop. p.) From the SUIF home page. verify that your current configuration accurately describes the number of Detectors you have installed. The software load automatically defaults to one Detector, unless you have done a successful restore and system reset. 10.) Restore System Calibration and Configuration files. 11.) Restore Protocol Data Base a.) Be assure the system language config are the same with the backuped database. From the Worklist screen, click the Service Tools icon. The Service Tools screen appears.  Worklist screen b.) Select [Preferences] and then [ Protocols] . c.) Insert the CD with the saved protocols database into the CD/DVD drive. d.) Click the [Retrieve] button. Page 194 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT  Service tools screen e.) A message appears: Press OK to continue with Protocol Database retrieve. f.) Click the [OK] button.The saved protocol database is now loaded onto your system. g.) Remove the CD from the CD/DVD drive and store it in a safe place. 12.) Restore System Images Chapter 11 - Software Instruction Page 195 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT a.) Use the [CD1] button to open the CD tray on the PC. b.) Select Eject CD from the drop-down list. The CD/DVD drive tray will open. c.) Place the CD with the images onto the tray and close. d.) Click the [CD1] on the top left corner of the screen. The exam list updates to now show you the images stored on the CD. e.) Select the exams you wish to retrieve. using the mouse. f.) Click the [Local] button as the destination (located on the lower left corner of the screen). g.) A message appears: Images will be copied to the selected exam. Images will not automatically be removed from the source exam. h.) Click [OK], when it appears. * If there is a problem and the exams cannot be copied to the selected network host: 1.) A message appears: The network destination is not responding. If the problem persists contact your network administrator. 2.) Click OK to close the message. 3.) Try copying the exams at a later time. * To see the status of the exams being copied: 1.) Click [Transfer Log] at the bottom of the Image Management screen. 2.) The Transfer Log screen appears. 3.) Click the [Close] button to close the screen and return to the Image Management screen. HPZ400 and HPZ440 has different OS, so OS configuration of backup CD can’t be restored into workstation of different OS system, or system will crash. If the old PC HPZ400 is replaced to new PC HPZ440, DO NOT perform restore OS configurations of old Z400 backup CD into new Z440 system. Need manually perform below steps. 13.) Restore the settings of the below OS configurations according to the photos you used to take when perform data backup. Page 196 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • • SUIF > Configuration - PNF:ON/OFF - NTP setting - Site parameters: IP Address/Subnet Mask/Default Gateway System Utilities screen > Network Connections - • SOFTWARE INSTALLATIONT RIS/PACS/Printer settings System Utilities screen > Preferences > Login Management - To create a special username/password for costumer manually. 14.) RIS/PACS/Printer settings Reload any applicable software patches. 15.) Re-checkout Insite. Different workstation of Galaxy has different Model type. When OLE make Insite checkout, field engineer need first check workstation type, then tell them choose responsible Model type. Z400 workstation uses _GALAXY while Z440 workstation uses _GALAXYZ440. Wrong model type will make checkout failure. 16.) Congratulations, you're finished. Unless, you're installing a new system. Then proceed on to calibration and configuration tasks. 2.5 Finalization 1.) Plug the ethernet cable. 2.) Perform Detector vertical bar and bad pixel cal. 3.) Perform QAP. 4.) Perform the Data, Time and NTP settings. 5.) Backup the system. Section 3.0Jedi Service Tool 3.1 3.1.1 Service Software User Guide Supplies None. 3.1.2 Tools • • • 3.1.3 Service manual CD (PN:5429484) TAV cable (PN:2207478) Laptop with Serial port and CD drive Safety Precautions Not applicable. Chapter 11 - Software Instruction Page 197 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 3.1.4  SOFTWARE INSTALLATIONT Prerequisites Basic knowledge of PC based computer laptop, DOS and usage of Microsoft WINDOWS. 3.1.5 Personnel 1 person. 3.1.6 Time 15 minutes. 3.1.7 Procedure 1.) If neccessary, unzip the files and put them into JEDISVC folder 2.) Loading service software on service laptop The Service software is a DOS application. It can operate under DOS or Windows; but for software download or database backup, it is required to run ASIAN.exe under DOS to avoid communication problem (with the mouse, click on START, SHUTDOWN, RESTART COMPUTER UNDER DOS MODE; see 4.1 - Software Download / Upgrade). To load the software on to the hard drive: • Power ON Service laptop. Under Windows, run the File Manager (Explorer)) • Create a new directory (e.g.: JEDISVC) under C:\ • Insert the "Service manual CD delivered with the equipment in the Service Tool set into the CD drive. • Copy JEDI service software from the CD to your hard drive. • Double click on \, drag and drop on C:\ JEDISVC or whatever name of your directory. The service software is installed and ready for use. 3.) Power off the system and switch off the breaker on PDU. 4.) Unplug the 5428628 cable that is to PC terminal, Connect this cable terminal to Laptop RS232 interface. 5.) Press the Reset button about five second and not release, then press the power on button and not release as shown in Figure3, wait about three second, then you will listen to a beep tone and look at the power on led flash, it indicates entering into Hub mode, you can be diagnosis the JEDI. 6.) Run the program: Under DOS: Page 198 * Select Disk drive from where you want to run the program: * C: [enter] * key in: “ASIAN” [enter] Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 • • SOFTWARE INSTALLATIONT Power ON the generator. Press function key F1. The following screen appears: The software will load the help screen information contained in Asiane .msg file. • Wait or press space bar to jump to screen. The Application screen will appear: Chapter 11 - Software Instruction Page 199  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT "English text Version 1.2" is displayed 5 sec., then display shows the last used parameters. Note: If the serial line to the generator is not operating (e.g.: cable not correctly connected, I/F or kV Control board down, Generator not ready or powered OFF), further screens will not be displayed and no function keys will operate. Correct this problem before continuing. 7.) Typical screen description 1 2 3 4 1 : Area for Parameters, Error codes. Controlled by JEDI Software. Display of exposure parameters setup in Application mode, depending on technique selection: kV, mAs, mA, Exposure time. (max. number of exposure in sequence, not used on Rad product.) Specific display in Maintenance Mode (Alt S or Alt D). 2 : Status area. Displayed by Service Software, Enlighten or blinking key controlled by JEDI Software. Page 200 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT Display of function keys usable with menu displayed. Commands are remembered in help area: Right arrow: Increase kV Left arrow: Reduce kV F1: Set 2 points mode F2: Set 3 points mode F3: Increase mA or mAs (3 points or 2 points) F4: Decrease mA or mAs (3 points or 2 points) F5: Increase Exposure Time F6: Decrease Exposure Time F9: Darkness correction + (w/t AEC Cell) F0 (F10): Darkness correction - (w/t AEC Cell) Lit when thermal limit is reached Lit when ready for exposure Error or impossible selection Lit during exposure Lit during exposure 3 : Select Technique, Screen film pairs, AEC cell, ... Keys always displayed, but will be active depending on configuration and technique selection. Includes help command. 1...4: Select workstation, whenever programmed in service menu TECH. 0: select Large focus 9: select Small focus A, B, C: Select screen film pair (Whenever programmed) A: Slow speed B: Medium speed C: High speed D, E, F: Select cell in AEC (Whenever programmed) D: Left cell E: Central cell F: Right cell R: to Reset whenever error occurs U: Toggle fast or normal kV change. Z: to display in area (1) the measured exposure parameters when "DISP" in menu 5 is set ON. APR valid: enlighten when the display in area (1) is valid for recording in Customized protocols. (Not used in RAD) 4 : Area for Static Help, related to screen in Service Mode. Displayed by Service Software. Chapter 11 - Software Instruction Page 201  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT SELECTING MAINTENANCE AND APPLICATION MODE; MAJOR KEYS FROM PROCEDURE TO APPLICATION MODE Type - (Together) SETUP/MAINTENANCE MODEMENU 3 APPLICATION MODE Type - (Together) SETUP/MAINTENANCE MODELAST MENU OR SUB-MENU selected. SETUP/MAINTENANCE MODE From any menu, type (several times if necessary) or APPLICATION MODE [Q] Return to application mode [R] Return to a higher level menu [W] Validate [ALT] & [S] (Together) Calibration mode (Menu 3) [ALT] & [D] Calibration mode (Last menu called) [ ] and [ ] In maintenance mode, to move through menus [F1] to [F0] Function keys with action based on context. Other keys Based on context. Main function recalled in the screen and also in sections wherever used. SERVICE MENU TREE BREAKDOWN • Type [ALT] & [S] (Together) to go to Maintenance Menus (MENU 3) • Type [ • Figure 1-1 shows the relationship between the Maintenance Mode menus and the function keys used to access those menus. To return to a higher level, key in [R] • ] and [ ] keys to select a menu. The darkened menus are used for Generator and room setup (Configuration and Calibration): menu 3, 4, 5. Menu 3 is used to Configure the system Menu 4 is used to calibrate AEC mode (Automatic Exposure Control) Menu 5 is used to perform Checksum Menu 1 is used to perform generator test and diagnostics. Menu 2 is used to enter Date and Time, view/clear error log, and view/clear tube and generator recorded tracking Data. Page 202 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT MENU 1 [F1] [F3] HEAT [F5] HIGH ANOD AUTO, 3,4,5 [F3] GATE CD Tst ShC INV Tst [F5] LIST MENU 3 AEC AUTO, 3k, 9k NoLD MENU 2 [F7] [F7] NEXP DATE [F1] [F5] TECH MODE MENU 4 [F7] [F5] AEC [F1] [F3] KG KVEF MENU 5 CAL [F5] KTIME [F1] CKS KF [F7] RAMS [F1] [F9] Vx Px.x DSPL [F3] MCL Figure 1-1 Service Menu Tree Breakdown SUB-MENU SUMMARY DESCRIPTION a.) Configuration - MENU3 TECH: programming workstation, technique parameters. MODE: Select Renard or Normal scale for kV selection. Calibration - MENU4 AEC: To set parameters if known, or modify them manually. CAL: To calibrate Automatic Exposure Control, for each AEC chamber and Screen-film combination. Chapter 11 - Software Instruction Page 203 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT b.) Ram - MENU5 RAMS: NVRAm operation & display: Note: CKSM: To update Checksum after configuration, calibration, parameter change. MCLR: Clear NVRam memory. Normally not to be used, unless specifically instructed. Do not use if Data Base backup has not been performed previously. Vx Px.x: Display generator software version (e.g. P3.3) DSPL: In Maintenance Mode, to display parameter after exposure using key [Z] c.) Utilities - MENU2 LIST: To display last recorded error codes (up to 64) - Last error is viewed with Date and Time Function keys allow to scroll down and up [Z] to get back to the last recorded error Same consecutive error are counted Up in the same line [^H ], and [W] to clear error log NEXP: To view/clear tube and generator recorded tracking Data. Clear must be performed only when replacing X-Ray tube. Meaning of each parameter is found in 4.2 - Tube Replacement Software Procedure. DATE: To enter / modify the date and time. d.) Diagnostics - MENU1 HEAT: To exercise Heater/filament function. - Auto: run fixed current on both filament (if 2 filaments) in sequence on selected tube (If more than 1). L or S: run 3, 4, or 5 Amps on Large or Small Focus. ANOD: To exercise Rotor function. - Auto: run rotation cycle in Low Speed then High Speed (If allowed by configuration) on selected tube. (If more than 1) 3k: run one cycle acceleration, hold, break in Low Speed on selected tube (If more than 1) 9k: run one cycle acceleration, hold, break in High Speed (If allowed by configuration) on selected tube (If more than 1) HIGH: To exercise High Voltage function. Note: Note: NoLD: To troubleshoot HV problem, without mA nor rotation with or without X-Ray tube. Test is run from 80 to max. kV, adjustable from 1 to 60 sec. Gate CD Test: to verify operation of the gate command board on the Inverter. Test is run during 10 sec. At 0 kV. Requires manual set up. Read related information in diagnostics section. ShC INV Tst: To verify operation of inverter with inverter in short circuit. Test is run during 100 msec. At 0 kV. Requires manual set up. Read related information in diagnostics section. AEC: To verify operation of AEC board. Refer to diagnostics section. Section 4.0Service Tool Job Cards 4.1 Software Download / Upgrade 4.1.1 Supplies None. Page 204 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.1.2 4.1.3 SOFTWARE INSTALLATIONT Tools • Service manual CD(PN:5429484) • • TAV cable (PN:2207478) Laptop with serial port and CD drive Safety Precautions Not applicable. 4.1.4 Prerequisites Basic knowledge of PC based computer laptop, DOS and usage of Microsoft WINDOWS. 4.1.5 Personnel 1 person. 4.1.6 Time 30 minutes. 4.1.7 Procedure 4.1.7.1 Load Software File on Service Laptop 1.) To load the software on to the hard drive(windows 2000 or under):It can operate under DOS or Windows; 2.) Power ON the computer, Under Windows, run the File Manager (Explorer); 3.) Create a new directory (e.g.: JEDITEST) under C:\; 4.) Insert the CD contained ”JEDI Software” delivered with the equipment into the CD-Rom; 5.) Copy all the files from the CD to your hard drive. 4.1.7.2 Unzip software file If necessary, you need to manually unzip the Jedi Software. 4.1.7.3 Software download 1.) Insert Service manual CD into Laptop; 2.) Create a new directory (e.g.: JEDITEST) under C:\ 3.) Copy all the JEDI service software from the CD to your hard drive 4.) Power off the system and switch off the breaker on PDU. 5.) Unplug the 5428628 cable that is to PC terminal, Connect this cable terminal to Laptop RS232 interface. 6.) Press the Reset button about five second and not release, then press the power on button and not release as shown in Figure3, wait about three second, then you will listen to a beep tone and look at the power on led flash, it indicates entering into Hub mode, you can be diagnosis the JEDI. 7.) Run the program: Under DOS: * Select Disk drive from where you want to run the program: * C: [enter] * key in: “ASIAN” [enter] Chapter 11 - Software Instruction Page 205 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT 8.) From the laptop software main screen, type “F7: restore memory”. 9.) Type bootP426.mx, then enter (or C:\JEDI\bootP426.mx) 10.) Wait for the count to start. When the software code transfer completes, wait 2 minutes for the next step. 11.) type applP426.mx, then enter (or C:\JEDI\applP426.mx). Wait for the count to start. It may take 20 seconds before starting. The software code transfer will take about 20 minutes. 12.) Verify the software version is P426, behind RAM text 13.) Select menu 2 with the arrows, select LIST, and clear generator error log. (^H, then W); 14.) To exit program, press Q, or R to return then ESC, or ESC twice. 4.2 4.2.1 Tube Replacement Software Procedure Supplies None. Page 206 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.2 Tools • • • 4.2.3 SOFTWARE INSTALLATIONT Service manual CD(PN:5429484) TAV cable (PN:2207478) Laptop with serial port and CD drive Safety Precautions Not applicable. 4.2.4 Prerequisites Basic knowledge of PC based computer laptop, DOS and usage of Microsoft WINDOWS. Knowledge of Service Software (refer to Chapter 11 - Software Instruction - Section 3.0 - Jedi Service Tool). 4.2.5 Personnel 1 person. 4.2.6 Time 15 minutes. 4.2.7 Procedure 4.2.7.1 Reset Tube Data tracking counter and error log. 1.) Plug TAV cable to Laptop serial port . Insert Service manual CD into Laptop. 2.) Create a new directory (e.g.: JEDITEST) under C:\ 3.) Copy all the JEDI service software from the CD to your hard drive 4.) Power off the system and switch off the breaker on PDU. 5.) Unplug the 5428628 cable that is to PC terminal, Connect this cable terminal to Laptop RS232 interface. 6.) Press the Reset button about five second and not release, then press the power on button and not release as shown in Figure3, wait about three second, then you will listen to a beep tone and look at the power on led flash, it indicates entering into Hub mode. 7.) Run the program: Under DOS: * Select Disk drive from where you want to run the program; * C:[enter] * key in:”ASIAN” [enter] 8.) Type ALT-S to jump to Service Menu 9.) Select menu 2 with the arrows. 10.) Type F5 to select “NEXP”. Chapter 11 - Software Instruction Page 207 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Note:  SOFTWARE INSTALLATIONT Before resetting all the memory, it is advised to record them on table 4.2.7.3 - Generator Counter Reading Record, found at the end of this Job Card. 11.) Enter ^H, press W to confirm. All the tube related Data will be erased; only Generator related Data will be kept. The filament ageing parameter will be reset to default value. Page 208 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 12.) Type Q to go back to main screen. 4.2.7.2 Verify new tube operation, clear error log 1.) Press F1 to jump to application screen. 2.) Run a dozen of exposures from low kv, mA, to high kV, mA in direct workstation. 3.) Verify correct operation of the system. 4.) Go in menu 2, LIST (F3); Clear the Error log. 5.) Exit from laptop service software. 6.) Run exposures from the Operating console. 7.) Take necessary steps to ship the replaced tube. Include filled out table with tube information. 4.2.7.3 Generator Counter Reading Record GENERATOR COUNTER READING RECORD Date of reading: Date of putting into service: Address of installation: Generator identification: Serial number: Software version: Options: (AEC) X-Ray system description: Counter name NO WARMUP Tube data Explanation Number of skipped Warm-up (N/A on Tiger) Chapter 11 - Software Instruction Page 209  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 4.2.7.4 SOFTWARE INSTALLATIONT RXGSF H Cumulated exposure time on small focus RXGLF H Cumulated exposure time on large focus RXSCOP H Cumulated exposure time in fluoro (N/A on RAD.) ROTANOD H Cumulated Anode rotation time NEXPSF Cumulated Number of exposure on small focus NEXPLF Cumulated Number of exposure on large focus N100%SF Cumulated Number of exposure on small focus at 100 % Power (N/A on Tiger) N100%LF Cumulated Number of exposure on large focus (N/ A on Tiger) NAMOR Cumulated Number of spits KJSF E Cumulated dissipated power on Small focus KJLF E Cumulated dissipated power on Large focus TIME_ON H Total generator Power On time (Not erasable) N_EXP_G H Total generator number of exposure (Not erasable) Tube Database Download The service tool software can operate under Windows (Windows 2000 or lower version) or DOS. 1.) Power off the system and switch off the breaker on PDU. 2.) Unplug the 5428628 cable that is to PC terminal, Connect this cable terminal to Laptop RS232 interface. 3.) Press the Reset button about five second and not release, then press the power on button and not release as shown in Figure3, wait about three second, then you will listen to a beep tone and look at the power on led flash, it indicates entering into Hub mode. 4.) Create a new directory (e.g.: JEDITEST) under C:\. 5.) Copy all the files from the CD to your new directory. 6.) Restart the computer in DOS mode (for software download or database backup, it is required to run ASIAN.exe under DOS to avoid communication problem). With the mouse, click on START, SHUTDOWN, RESTART COMPUTER UNDER DOS MODE. 7.) Run the program: Under DOS: * Select Disk drive from where you want to run the program; * C:[enter] * key in:”ASIAN” [enter]. 8.) Press function key F7 to Load Software according to the tube installed. - 50 kW tube: type 5331186 File: VMNSVDR?.mx (? means the current revision) 9.) When the successful installation message display, press Esc button on the computer. 10.) Press the function key F1 into the Jedi application interface. 11.) Press Alt and S key together to enter service interface. 12.) Set Date&Time. Page 210 Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT - Call Menu 2 using the arrows on the keyboard. - Call DATE by pressing F7. - Enter date (MM DD YYYY) via numeric keypad. - Hit W to confirm. - Hit F1. - Enter time (HH MM) via numeric keypad. - Hit W to confirm. 13.) Checksums Checksums must be validated at the end of the generator setup or whenever a parameter is changed. - Call Menu 5 using the arrows on the keyboard. - Press function key F1. - Press function key [F1] and [V] simultaneously. - A buzzer will sound, which indicating that the sums have been checked and OK on display screen. 14.) Press "R" key to return to the application mode. 15.) Press Esc key to exit the JEDI software. 4.3 Exposure mode while opening the jedi service tool when Service engineer make a diagnosis for JEDI with the Service diagnosis software in laptop, it needs to expose by pressing hand switch while openning the jedi service tool. This section will tell you the way to achieve it. 1.) Close the system by clicking shut down button on Application platform. 2.) Unplug the 5428628 cable that is to PC terminal, Connect this cable terminal to Laptop RS232 interface. Chapter 11 - Software Instruction Page 211 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT 3.) Press the Reset button about five second and not release, then press the Power on button and not release, wait about three second, then you will listen to a beep tone and look at the power on led flash, it indicates entering into Hub mode, you can be diagnosis the JEDI. 4.) Make some exposures with hand switch, the following picture are some explanations for pressing hand switch. Page 212 - When pressing hand switch, the tube anode rotation as shown below. - When pressing hand switch for high voltage test, the state from OFF to ON and show 80K as shown below. Section 1.0 - System Data Backup and Restore  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SOFTWARE INSTALLATIONT 5.) Press Shut Down button in Application screen and switch off the breaker on PDU to end the Hub mode. Chapter 11 - Software Instruction Page 213 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 214 Section 1.0 - System Data Backup and Restore  SOFTWARE INSTALLATIONT GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SOFTWARE INSTALLATIONT Chapter 12 Regulatory Test Procedure Only qualified service engineer is allowed to conduct the test involved in this capater. Section 1.0 Electrical Safety Equipment Grounding Please refer to the document named 46-014505 in manual CD. Section 2.0 Electrical Safety Leakage Current Please refer to the document named 46-014546 in manual CD. Chapter 12 - Regulatory Test Procedure Page 215  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 216 SOFTWARE INSTALLATIONT -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Chapter 13 Illustrated Renewal Parts Section 1.0 Illustrated Renewal parts Note: 1.1 1.2 If any brake is replaced, please use electric iron to seal the cable. Service Tool Part Number Detailed Part Description Quantity 5440337 Galaxy installation Service Tool 1 Part Number Detailed Part Description Quantity 5456538 CASTOR 4 5457304 Tabletop 1 5503733 GST-2 TABLETOP 1 Table Chapter 13 Illustrated Renewal Parts Page 217  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5457304 5456538 1.3 Page 218 Image Chain Part Number Detailed Part Description Quantity 5436666 SUPER VALUE RAD 1 5136302 Lamp, 24V 1 5331186 Vamana SVRAD Tube Assembly 1 5429399ROHS Chongqing Hualun XS-1D collimator 1 5429402 Galaxy 40lp grid with frame 1 5429405 Galaxy 70lp grid with frame 1 5270546 20mm Al phantom for Pioneer DR 1 5449033 AID Ion Chamber 1 5444618 DAP meter 1 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 5136302 5429399-ROHS ILLUSTRATED PARTS LIST 5429402/5429405 5270546 5436666 5331186 5449033 1.4 Control Room Part Number Detailed Part Description Quantity 5429246 TM:Terminal for exposure handswitch and power on 1 5439061 Hand switch with RoHs compliance 1 5448740 Handle Switch Support Assembly 1 5498484 X-Ray 19 INCHES COLOR MONITOR 1 5271574-2 USB linear bar code scanner (optional) 1 Chapter 13 Illustrated Renewal Parts Page 219  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 • • Note: ILLUSTRATED PARTS LIST For PC HP Z400: Part Number Detailed Part Description Quantity 5810000-4 DVD+/-R/RW/ROM SuperMulti Optical Drive 1 5810000-8 Single Socket PC 475W Power Supply (Section 4.3) 1 5810000-10 Single Port Gigabit Ethernet PCI-e Card per Section 7.3 1 5810000-A GDXR Console Workstation XR Super Value DR 1 5810000-D the 250G hard disk 10K RPM 512eAF 1 5430746 Galaxy APPCD 1 5430754 Galaxy OS 1 For PC HP Z440: Part Number Detailed Part Description Quantity 8770000-100 RAM DDR4 8GB ECC Registered DIMM, 2133GHz or higher 1 5723590-29 Slim Line SATA Optical Multi Drive 1 8770000-129 NIC PCIe Dual Port 1GbE RJ45, i350T2 (network port) 1 8770000-130 PSU HP Z440 700W (power supply) 1 8770000-110 HDD SATA 1TB 7.2K enterprise-class 1 8770000-112 GPU PCIe Nvidia NVS315 vbios 75.19.88.22.0B (display card) 1 8770000-11 HP Z440 E5-1620v3 16GB NVS315 SSD for DGS Galaxy (main board) 1 5761443 Galaxy OS compatible with HP Z440 part 8770000-11 1 5761441 Galaxy APPCD compatible with HP Z440 part 8770000-11 1 1.) PC HP Z440 (8770000-11) as well as its Low level FRU parts aren’t compatible to old generation PC HP Z400(5810000-A) as well as its low level FRU parts. 2.) When FE need to replace the whole PC HP Z400(5810000-A), please confirm below two cases: - Page 220 In case PC HP Z400 is still available in GPRS stock, FE can order PC HP Z400 and its compatible CD (APP 5430746, OS 5430754); Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 - ILLUSTRATED PARTS LIST In case PC HP Z400 is used up, FE needs to order new generation PC HP Z440 with its compatible CD (Z440 PC 8770000-11 + New OS 5761443+New App CD 5761441) and install new OS/APP after the order is delivered. 3.) When FE replace the low level FRU parts of 8770000-11 and 5810000-A, make sure to check model type of PC firstly and then order right FRU accordingly. - for example, if the PC type in field is Z400 and you need to order low level hard disk FRU 5810000-D, you should confirm whether the part 5810000-D is still in GPRS stock. If Z400 low level FRU part 5810000-D is used up, you must order the whole new generation PC 8770000-11 with new OS and APP CD (Z440 PC 8770000-11 + New OS 5761443+New App CD 5761441) together instead of the old ones. 5429246 5439061 5448740 1.5 PDU Part Number Detailed Part Description Quantity 5450079 relay RH2B-ULDD24 1 5435232 Transformer 1100VA 1 5500296 Power supplier assembly 1 5435236 Relay LY4-D 1 5435247 Breaker S203 1 5443099 Galaxy PDU fuse kit 1 5443496 Insulation board assembly 1 5447355 Contactor A50-30 coil220V 1 5428661 IF power cable 1 5428664 IF-Jedi cable 1 5432234 IF room-door open switch cable 1 5432235 Jedi x-ray on lamp cable 1 Chapter 13 Illustrated Renewal Parts Page 221  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5447355 5435247 5500296 5450079 5435236 5443099 5435232 1.6 1.7 Page 222 5443496 MIS Cable Part Number Detailed Part Description Quantity 5428622 PC power cable 2 5428628 PC RS232 cable 1 5428630 IF-TM cable 1 Part Number Detailed Part Description Quantity 021-0144 Pioneer program need PSP Document GB-T276 608-2Z Bearing 8 U-Arm Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5122632 HV Cable 2 5450079 relay RH2B-ULDD24 1 5394097 Power supply for URP detector 1 5428629 PC ethernet cable 1 5428631 U-ARM power cable 1 5428632 IF Spine cable 1 5428635 Vertical POT cable 1 5428636 Tube-side LCD cable 1 5428638 Angle-meter cable 1 5428639 SID POT cable 1 5428645 Vertical lock and limit switch cable 1 5428647 Detector fan cable 1 5428663 Collimator power cable 1 5428665 U-ARM main PE cable 1 5428666 Tube rotator cable 1 5428672 Vertical POT and lead cable 1 5428673 SID POT and lead cable 1 5428769 Detector fan and lead cable 1 5428858 Handle tansfer cable 1 5428859 Detector housing GND 1 5428931 Spine power cable 1 5428934 Detector power cable 1 5429133 Motor control cable 1 5763069 New Galaxy IF PWA 1 5429135 Galaxy interface board with firmware. Note: If this part is use up and can’t be ordered anymore, please order the other new IF board part 5763069 for instead. 1 5430955 U2 handle membrane 1 5430961 Spine PWA with Firmware 1 5430979-1 SVDR Console LCD with pictures 1 Chapter 13 Illustrated Renewal Parts Page 223  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 Page 224 ILLUSTRATED PARTS LIST 5430982-1 SVDR Configured Servo 1 5430986-1 SVDR Angle LCD with pictures 1 5432235 Jedi x-ray on lamp cable 1 5433031 Detector housing signal cable 1 5435322 Encoder connection cable 1 5435323 motor connection cable 1 5435324 rotation lock cable 1 5435327 estop button and lead cable 1 5437495 Ion chamber cable for galaxy 1 5439053 angle meter cover1-1(575P) 1 5439843 Lock Handle 1 5439844 Spring 1 5443085 Steel rope 2 5443863 tube - cover L-D 1 5444677 Spring 1 5445490 LCD-cover-D 1 5445505 Cable sleeves 1 5445536 gear cover top 1 5446111 U3 Front board and picture(575P) 1 5446298 Chin rest and frame 1 5446299 power supply of 150w 1 5447915 Brake 1 5447916 patient barrier 1 5448732 Lock Handle 1 5448734 Limit switch, Galaxy 2 5451267 Tube handle of U-arm 1 5452377 Brake on Arm 1 5452378 V3M11-Tube Handle 1 5452427 gear cover down 1 5453213 Brake on top box 1 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5453214 V3M21-Tube Handle 1 5454855 Angle meter cover1-2(575P) 1 5456202 grid detent 1 5456313 Motor and component 1 5457298 Bearing 8 5457299 tube - cover L-U 1 5458077 LCD-Cover_F 1 5458080 safe lock 1 5458806 Grid-in switch used in Galaxy 1 5458808 Handle 1 5459299 The spring of U-arm rotation detent. 1 5461124 tube - cover-R 1 5461879 Detector housing left part 1 5447187 Manual U-ARM Vertical lock cable 1 5444763 angle meter cover 1 5429575-299 Brivo XR575 Operator Manual CD 1 5447984 Anchor Screw 5447984 6 5455420 bearing 1 5491345 SID BRAKE FOR IECv3 1 5150458 OTS Switch Power Supply 1 Chapter 13 Illustrated Renewal Parts Page 225  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5430961 5443085 5458806 5446298 5444677 5458808 5439843 Page 226 Section 1.0 Illustrated Renewal parts 5448732  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5447916 5491345/5447915 5435327 5461879 5451267 5445536 5452427 5453214 5452378 Chapter 13 Illustrated Renewal Parts 5430955 Page 227  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5444763 5428769 5452377 5394097 5453213 5446299/5150458 5430982-1 Page 228 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5430979-1 5448734 5430986-1(575P) 5456202 5439053(575P) 5461124 5454855(575P) 5457299 5450079 5443863 5456313 5459299 Chapter 13 Illustrated Renewal Parts Page 229  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 5763069/5429135 5445490 5458077 5443085 5458080 5439844 1.8 JEDI Generator Renewal Parts 1.8.1 Introduction This Section provides information for the identification of Renewal Parts for the JEDI 50 R 1T generator. 1.8.2 Page 230 JEDI Generator Renewal Parts List Part No. Description Quantity /Unit 2202419 I/F RAD - AEC cable (option) 1 2214527-4 JEDI STD HV TANK (SPARE) 1 2217057-2 FIRST AID SPARES_RoHS Complaint 1 5119911-2 FRU AEC Board-ROHS Compliant 1 5641043 FRU-Programmed Jedi Rotation V3 board 1 5126988-3 LVPS 3PH V5_FRU RoHS 1 5126989-2 INVERTER MID POWER ASSY_FRU RoHS 1 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.8.3 ILLUSTRATED PARTS LIST 5436156 PROGRAMMED KV CONTROL BOARD P5.47 5,59 1 5126997-2 AC-DC 3PH MID POWER ASSY_FRU RoHS 1 5126999-2 EMC FILTER TRI V2B_FRU RoHS 1 5127015-2 FRU_RAD IF BOARD_RoHS Complaint 1 2409047 FILAMENT BOARD 1 INVERTER V3.01 1 99185290 Fuse 15A 1 2121569 Power bridge 1 2200700-2 INVERTER COIL MID POWER ASSY RoHS COMPLIANT 1 2159419 Non-Volatile parameters RAM 1 2208000 Assy AEC cable 1 2198191 KV Measure - KV Control cable 1 2215903 ROT / LVPS / Heater cable 1 5133341-2 FRU FOR CAPA INVERTER ASSEMBLY FOR 50 RADRoHS Compliant 2 2202418 KV control - I/F RAD cable 1 2221983 CAN cable 1 2198185 KV Measure - Gate Command cable 1 2214511 System cable 1 5127015-2 FRU_RAD IF BOARD_RoHS Complaint 1 5304700 Battery FRU for KV control 1 5392131 FRU- Programmed Heater V7 Board 1 FRU Information Information shown for each FRU (Field Replaceable Unit) is explained below. Wherever possible, the FRU or its position is illustrated for easy identification. Chapter 13 Illustrated Renewal Parts Page 231  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST FRU name Inverter PW Assembly 2187001  Inverter Capa Assembly 2203900 Items shown in this way are included in the FRU shown immediately above, but may also be ordered separately. Part number for ordering Notes. These may include: Reference to an illustration with more information Reference to a relevant Disassembly/Reassembly Job Card Items included with the FRU etc. When need to replace the part, please use the standard usual tools. Page 232 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.8.4 ILLUSTRATED PARTS LIST Jedi 50 R 1T Structure JEDI 50 R 1T 2212259-2 JEDI STD HV Tank 2214527-4 Power Unit HLB 2214447-2 Module Auxiliaries 50 R 1T 2215808 System cable 2214511 Module Power 50 R 1T 2229597 CAN Cable 2221983 Equipped AC/DC 50 R 1T 2221722 Service Tools 2228546 Interface Module 50 R 1T 2205629-2 First Aid Spares 2217057-2 AEC Board (option) 2204112-2 AEC I/F Cable 2202419 Chapter 13 Illustrated Renewal Parts Page 233  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.8.5 ILLUSTRATED PARTS LIST Renewal Parts AC/DC Unit Interface Unit Power Unit Auxiliary Unit TOP VIEW Interface Unit AC/DC Unit Auxiliary Unit Power Unit Jedi Standard HV Tank REAR VIEW Figure 13-1 JEDI 50 R 1T Generator Location of Main Assemblies Miscellaneous Items: First aid spares: 1 short circuit cable 1 fuse 15 A 700 VDC 1 fuse 10 A 250 V 10 M4-8 mm screws 10 tie-wraps Page 234 Services tools Service software, 2227656 RS232 Cable, 2207478 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST AC/DC 3 Phase Mid Power Assy (Board & Rectifier + 2 cables) 2214995 5126997 FRU: 1 -2 Job Card D/R JEDI 17-30 EMC Filter Board 2209840 5126999 FRU: 1 -2 Job Card D/R JEDI 17-29 AC/DC Unit AEC Board V1 2184569-2 -2V22222253 5119911 AEC Board FRU: 1 Job Card D/R JEDI 17-36 RAD I/F Board V1 2184567-4 5127015-2 RAD I/F Board V2 2226456FRU: 1 Job Card D/R JEDI 17-25 Interface Unit Rotor Board High Speed 2214605-3 5392132-4 2409043 FRU: 1 Job Card D/R JEDI 17-35 LV Power Supply 3 Ph Board 2212166 5126988-3 5126988-2 FRU: 1 Job Card D/R JEDI 17-33 Filament Board 1 Inv. 2214604 2409047 FRU: 1 Job Card D/R JEDI 17-34 Auxiliary Unit Figure 13-2 JEDI 50 R 1T AC/DC Unit, Interface Unit & Auxiliary Unit Chapter 13 Illustrated Renewal Parts Page 235  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Inverter Coils Mid Power Assy 2200700 -2 FRU: 2 Job Card D/R JEDI 17-31 Capa Inverter Assy 2229505 5133341 FRU: 2 -2 Job Card D/R JEDI 17-32 A Non-Volatile parameter RAM 2159419 FRU: 2 Job Card PM JEDI 15-2 Programmed kV Contro Board 2214606-2 5126994-3 5436156 FRU: 1 Job Card D/R JEDI 17-2 Inverter Mid Power Assy 2215814FRU: 1 5126989 -2D/R JEDI 17-24 Job Card A Jedi Standard HV Tank 2214527 -4 FRU: 1 Job Card D/R JEDI 17-23 Figure 13-3 JEDI 50 R 1T Power Unit Page 236 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.8.6 ILLUSTRATED PARTS LIST Cables DC_BUS N to INVERTER DC_BUS P to INVERTER DC_BUS to Auxiliary Unit (Rotation Board) 88 Not Used J1 9pts AEC Board J4 Not Used Not Used Room Door Interface W22 Service Laptop Console 9 pts J7 9 pts J5 9 pts J6 9 pts J8 25 pts J9 PH3PH2PH1 J3 DC_BUS+ DC_BUSJ1J2J3 DC_BUS to Power Unit (Gate Command Board) DC_BUS M J5 16 pts PH1 PH2 J2&TP2J1&TP1 PH3 9pts 9pts EMC Board AC/DC Board I/F Board 64 pts J10 16 J3 pts 1 1 22 AC/DC Unit 3 3 AEC1 9 pts THREE PHASES + Ground from PDU 9 AEC2 pts Interface Unit Keyed Connections 1 I/F RAD - AEC cable 5 2202419 2 Assy AEC cable 6 KV control - I/F RAD cable 7 ROT / LVPS / Heater cable 2215903 CAN cable 2221983 KV Measure - KV Control cable 2198191 2202418 4 KV Measure - Gate Command cable 2198185 2208000 3 From KV Control board 8 System cable 2214511 Chapter 13 Illustrated Renewal Parts Page 237  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 8 8 DC_BUS N 70 o C DC_BUS P DC_BUS to ACDC Unit J1 DC_BUS to ACDC Unit J3 Rotor to Tube NP anode 1 cathode 11 Power Unit Inverter grey red 1 1 J3 HV Tank 1 - + L0 S F F 1 -+ ACP J3 J1A KV Measure Board J1 J2A CF-N CF-P J1 CF3 CF4 77 CAN 66 J2 26 pts J1 44 50pts LVPS CAN Board CF1 CF2 1 55 KV Control Board 26pts J2 J2 J3 34 pts J2 50pts to IF Board 1 26pts J1 Gate J4 Command1 34 Board pts 33 1 1 Rotation Board High Speed ILr ILp blue 6 5 4 3 J2 26 pts J1 grey 9 26pts CF1 CF2 Filament Board 1 Inv. 1 26 J3 pts Auxiliary Unit 64 pts Keyed Connections 1 I/F RAD - AEC cable 5 2202419 2 2198185 Assy AEC cable 6 2208000 3 KV control - I/F RAD cable 7 1.9 ROT / LVPS / Heater cable 2215903 CAN cable 2221983 KV Measure - KV Control cable 2198191 2202418 4 KV Measure - Gate Command cable 8 System cable 2214511 JEDI Generator Disassembly/Reassembly 1.9.1 Introduction This section provides information to dismount and remount FRU (Field Replaceable Unit). 1.9.2 Tools Serviceability of Jedi Generator requires the following tools: Page 238 Section 1.0 Illustrated Renewal parts to Tube  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST K J I F C E a D B 1.9.3 G H Digital Multimeter (A) Phillips Screwdriver (B) Allen Key (C) Screwdriver With Interchangeable Socket Head (D) Long Extension for Ratchet Wrench (E) Short Extension for Ratchet Wrench Cutting Pliers High Voltage Wrench Ratchet Wrench Socket Wrench Hexagonal Head Socket Set (F) (G) (H) (I) (J) (K) HV Tank, 1 Tube, 1-3 Phase 1.9.3.1 Supplies None 1.9.3.2 1.9.3.3 Tools • 5.5 mm nut driver or socket wrench with ratchet. • 3 mm Allen wrench. • 13 mm socket with ratchet. Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.3.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. Chapter 13 Illustrated Renewal Parts Page 239 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST THE WHOLE GENERATOR WEIGHS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.3.5 Personnel 1 person. 1.9.3.6 Time 1 hour 30 minutes. 1.9.3.7 Disassembly 1.) To release the Power Unit, follow the instructions of Disassembly / Reassembly procedure of 1.9.4 Inverter Mid-Power Assembly. Observe the Caution relating to dangerous voltages, and the Warning relating to the weight of the generator! Do not remove the two EMC panels from the top of the Power Unit. 2.) Disconnect the cable 1 connected to J3 on the KV Measure Board. 3.) Disconnect the short ribbon cable 2 connecting J2 on the Gate Command board (Inverter Assembly) to J1 on the KV Measure Board (HV Tank). 4.) Disconnect the wider short ribbon cable 3 connecting J2 on the KV Control Board to J2 on the KV Measure board (HV Tank). 5.) Using a 13 mm socket wrench, remove the three nuts 4 attaching the primary coil flat cables Page 240 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST to the round capacitors located on the shelf just above the KV Control Board. 6.) Remove the two screws 5 on the HV Tank rear side. Take great care not to let screws fall into the HV connector receptacles. Cover them with plastic caps. 6 7.) Remove the 5.5 mm screws: three at the front side 6 (two at right, one at left) and three at the right side 7 . Chapter 13 Illustrated Renewal Parts Page 241  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 8.) At the rear side, remove the eight 3 mm Allen screws 8 Inverter Mid Power Assembly to the HV Tank. which secure the heat sink of the 9.) Take off the assembly constitued by five parts: EMC covers, Coils Inverter Assy, Capa Inverter Assy, Mid Power Assy and KV Control Board. The HV Tank is now free 9 . 9 1.9.3.8 Reassembly Reverse the disassembly procedure to reassemble and replace the unit. 1.) Mount the flat cable J1 on the kV Measure Board of the new HV Tank (refer to (refer to Disassembly section 2 ). 2.) Reassemble the HV Tank with the other elements of the Power Unit (refer to Disassembly section 9 ). 3.) Mount the eight 3 mm Allen screws to secure the heat sink of the Inverter Mid Power Assembly to the HV Tank. (refer to section Disassembly 8 ). Tighten to torque 8 N.m (80 kg.cm). 4.) Put back the 3 front 5.5 mm hex head screws (refer to section Disassembly 6 ), one at the left side,two at the right side. Tighten them between 1.5 to 2 N.m (15 to 20 kg.cm). 5.) Reconnect the short ribbon cable from J1 on the KV Measure board to J2 on the Gate Command board (refer to section Disassembly 2 ). 6.) Using the 13 mm socket wrench, connect the primary coil flat cables to the three capacitors 1 Page 242 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST ). 1 2 The two flat cables with white bands on them go both together on the middle capacitor with the parallel resonant cable (refer to section Reassembly 2 ). 7.) Reconnect the cable to J3 on the KV Measure Board (refer to section Disassembly 1 ). Tighten the nuts to 8 N.m (80 kg.cm). 8.) Reconnect the wider short ribbon cable from J2 on the kV Control board to J2 on the kV Measure Board (refer to section Disassembly 3 ). 9.) Mount the two 5.5 hex head screws securing the cover to the HV Tank on the HV outlet side (refer to section Disassembly 5 ) and the three screws on the other side (refer to section Disassembly 7 ). Tighten the screws between 1.5 to 2 N.m (15 to 20 kg.cm). 10.) Mount the Power Unit on the support plate. THE POWER UNIT WEIGHTS 30 KG (66 POUNDS). 11.) Refer to Disassembly / Reassembly procedure of 1.9.4 Inverter Mid-Power Assembly to complete reassembly of the Unit. 12.) Put 5 cl of oil into the HV receptacles. Reconnect the HV cables. 1.9.3.9 Verify Connect the service laptop (refer to Software - Jedi Service Tool - Section 1.0 Jedi Service Software User Guide) and proceed to "HV no load diagnostics" to ensure correct operation. Skip steps "Gate Command and Inverter in Short Circuit" diagnostics. 1.9.4 Inverter Mid-Power Assembly 1.9.4.1 Supplies None Chapter 13 Illustrated Renewal Parts Page 243 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.4.2 1.9.4.3  ILLUSTRATED PARTS LIST Tools • 5.5 mm nut driver or socket wrench with ratchet. • 3 mm Allen wrench. • 13 mm socket with ratchet. • C-clamp for HV connections. Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED.THESE LEDS INDICATE THE PRESENCE OF DANGEROUS VOLTAGE ON THE POWER SUPPLY CAPACITORS. Look through the front of the power unit; observe leds ds 1 at the top of the dual snub board and ds 300 at the right hand end of the gate command board. if either is lit, wait until both are off before proceeding further. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.4.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.4.5 Personnel 1 person. 1.9.4.6 Time 2 hours. Page 244 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.4.7 ILLUSTRATED PARTS LIST Disassembly 3 1 1 3 4 4 2 2 5 TOP VIEW FRONT VIEW 5 1 4 2 3 AEC2 AEC2 AEC1 AEC1 1 AC/DC UNIT 2 POWER UNIT 3 INTERFACE UNIT 4 AUXILIARY UNIT 5 SUPPORT PLATE TABLE TABLE BUCKY BUCKY WALL WALL BUCKY BUCKY DOOR DOOR LAPTOP LAP TOP CONSOLE CONSOLE Figure 13-4 JEDI 50 R 1T Generator General View Chapter 13 Illustrated Renewal Parts Page 245  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the Auxiliary Unit 1 2 3 1.) Disconnect the connectors J2 and J3 and ground cable on the top of the generator 1 . 2.) Remove four 5.5 mm hex head securing screws holding the Auxiliary Unit on the support plate 2 . 3.) Disconnect the flat ribbon cable 3 , without tearing, between the Auxiliary Unit and the Interface Unit. 4.) Remove the Auxiliary Unit. Remove the Interface Unit 2 1 3 1.) The Interface Unit appears after removing the Auxiliary Unit. Release the flat ribbon cable 1 ,making it sliding along the cover panel 2 of the Interface Unit. 2.) Unscrew twelve 5.5 mm screws that retain the cover panel and remove this one 2 . 3.) On the I/F Rad Board, disconnect the flat wide ribbon cable J10 3 Page 246 Section 1.0 Illustrated Renewal parts linked to the KV Control  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 Board. ILLUSTRATED PARTS LIST THE POWER UNIT WEIGHTS 30 KILOGRAMS (66 POUNDS). DO NOT TRY TO LIFT IT WITHOUT ASSISTANCE. 4.) Unscrew twelve 5.5 mm screws securing the Interface Unit box to the Power box. 5.) Taking care of the flat wide ribbon cable 3 ,remove the Interface Unit box. The components of the Power Unit appear: coils assembly, capacitors assembly, KV Control Board. 3 Remove the AC/DC Unit and the support plate 3 5 2 1 2 5 1.) On the top of the generator, the two connectors 4 1 are fixed mecanically on the support plate. Unscrew connectors screws in order to release the 4 power cables 2 the Power Unit and the AC/DC Unit. coming from 2.) Remove the screw securing the ground cable on the AC/DC Unit. Disconnect the cable 3 linking the AC/DC Unit and the Power Unit 4 . 3.) Remove the four screws 5 on the support plate in order to release the Power Unit. This one is then free. Chapter 13 Illustrated Renewal Parts Page 247  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the Inverter Mid Power Assembly 2 3 1.) Remove the 5.5 mm hex head screws which secure the two EMC cover panels 1 side of the Power Unit; remove the panels. at each 2.) With a 10 mm socket wrench with ratchet 2 ,remove the three hex head screws securing the Page 248 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST cables Q100C 3 , Q100E and Q200C on the Inverter Mid Power Assembly. 5 A 7 A 6 8 3.) Disconnect flat ribbon cables from J1 and J3 on the Gate Command Board 4 and disconnnect J4 at the right hand side of the board. 4.) With 10 mm wrench, disconnect the parallel Coil connection from the Current Transformer pass through 5 and with 13 mm wrench the other connection from the Capacitor Assembly 6 . 5.) Remove the eight 3 mm Allen screws 7 which secure the Inverter Mid Power Assembly to the HV Tank. Chapter 13 Illustrated Renewal Parts Page 249  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 6.) Remove the Inverter Mid Power Assembly 8 1.9.4.8 . Reassembly 1.) Present the new Inverter assembly. Put back the eight 3 mm Allen screws to secure the Inverter Mid Power assembly to the HV Tank (refer to section 1.9.4 Inverter Mid-Power Assembly 7 ). Tighten them firmly to torque 2 N.m (20 kg.cm). 2.) Remount all cables that were removed: a.) Remount the three Coil cables on the Inverter IGBT's with three 5.5 mm screws. Tighten them firmly to torque 3 N.m (30 kg.cm). RESPECT THE ORIENTATION OF THE CABLES TO THE IGBTS CONNECTIONS TO AVOID CABLE CONTACT WITH TOP COVER. b.) Reconnect the short flat cable between the HV Tank and the Gate Command board (J3), and the inverter current feedback cable (J1) on the Gate Command board (refer to section 1.9.4 Inverter Mid-Power Assembly 4 ). c.) Reconnect the DC bus cable to J4 to the right hand side of the Gate Command board. + Top J4 - d.) With the 10 mm screw and flat and lock washer, reconnect the shorter cable of the parallel coil on the Inverter assembly onto the right hand side current transformer (Ti1/100) pass through. A . Tighten to 3 N.m (30 kg.cm) torque. Page 250 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST B e.) With the 13 mm screw, with flat and lock washer, reconnect the longer cable of the coil on the central capacitor (C3UF) of the Capacitor assembly, together with the two primary HV Transformer flat wires (the two with a white ring). B Tighten to 8 N.m (80 kg.cm) torque. 3.) Perform an overall inspection before proceeding. Use the following illustration to check the connections are right. Chapter 13 Illustrated Renewal Parts Page 251  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Parallel Coil Q100C Q200C C C Q100E E Inverter Assembly E Coil Assembly + + DC Ti1/40 Ti1/100 - - DC Capa Assembly C3UF HV Tank 4.) Remount the two EMC panels on the top of Power Unit with the 5.5 hex head screws. Tighten all the cover screws to torque between 1.5 to 2 N.m (15 to 20 kg.cm) 5.) Assemble the Power Unit with the AC/DC Unit on the support plate with 5.5 mm hex head screws. Put back in place the disconnected cables: ground, DC bus (refer to section 1.9.4 Inverter Mid-Power Assembly). 6.) Remount the Interface Unit on the support plate then the Auxiliary Unit. Follow the inverse procedure indicated in the sections and . 7.) Remount the generator inside the table. 1.9.4.9 Verify Run HV LOAD DIAGNOSTIC - "Inverter in Short Circuit Diagnostics" and "Inverter Gate Command Diagnostic" are not pre-requested. Verify correct operation on the whole application range. 1.9.5 I/F Board RAD 1.9.5.1 Supplies None Page 252 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.5.2 ILLUSTRATED PARTS LIST Tools 5.5 mm nut driver or socket wrench with ratchet. 1.9.5.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.5.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.5.5 Personnel 1 person. 1.9.5.6 Time 15 minutes. 1.9.5.7 Disassembly The I/F Board Rad is situed in the Interface Unit. To reach this Unit, the Auxiliary Unit has to be released from the generator. Follow the instructions of 1.9.4 Inverter Mid-Power Assembly. Remove the I/F Board Rad 1 4 2 5 3 1.) Disconnect the flat ribbon cable 1 and the two cables 2 , if existing, coming from the AEC Board. 2.) Disconnect the flat wide ribbon cable J10 coming from the KV Control Board 3 . Chapter 13 Illustrated Renewal Parts Page 253  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 3.) Remove the four screws of connectors J8 and J9 4 . 4.) Remove the ten 5.5 mm screws 5 1.9.5.8 securing the Interface Board Rad; remove the board. Reassembly 1.) Reverse the disassembly procedure to reassemble the unit. Tighten screws to torque between 1.5 and 2 N.m (15 to 20 kg.cm). 2.) Power the system on and verify that the system functions properly. 1.9.6 KV Board RAD 1.9.6.1 Supplies None 1.9.6.2 1.9.6.3 Tools • 5.5 mm nut driver or socket wrench with ratchet. • 10 mm Allen wrench. • 13 mm socket with ratchet. Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.6.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. The KV Control board contains a saved memory Database with essentially the following parameters: • Tube configuration parameters, AEC calibration parameters, and Room configuration (workstation, AEC, screen film pairs). • Filament aging variable • Error Log • Recorded parameter data If it is possible, backup database first. Else, the diagram hereafter helps you to determine the action to take for your situation. Page 254 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST First Calibration Configura* tion Upload Database Yes Save Non Volatile RAM Database DB Upload Possible? KV Control Out of Order Is original DB saved? (*) No No Yes SW OK? Replace KV Control Replace KV Control Replace KV Control No Download Software Yes Yes Download Database SW OK? Yes SW OK? No No Download Software Download Software Download Original Database (*) Configura* tion if applicable Calibrate if applicable Reset Database: * Date * Time * Clear Error log Operational Checks Save Non Volatile RAM Database (*) or most recent 1.9.6.5 END Personnel 1 person. 1.9.6.6 Time 45 minutes. 1.9.6.7 Disassembly The KV Control board spare is pre-loaded with NP/NP+ software.  It will be required to download the software that is on site. DATABASE RESTORE IS MANDATORY. Chapter 13 Illustrated Renewal Parts Page 255 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST Remove the Auxiliary Unit Remove the Auxiliary Unit as described in 1.9.4 Inverter Mid-Power Assembly. Remove the Interface Unit Remove the Interface Unit as described in 1.9.4 Inverter Mid-Power Assembly. Remove the kV Control Board 1.) Disconnect the cables from J1, J2 and J3 on the kV Control Board 1 . 2.) Remove the seven 5.5 mm hex head screws which secure the kV Control Board; remove the board 2 . 1.9.6.8 Reassembly Reverse the disassembly procedure to reinstall the KV Control board and the Interface Unit. Tighten 5.5 mm screws to torque between 1.5 and 2 N.m (15 to 20 kg.cm). 1.9.6.9 Verify 1.) Connect the Service Laptop (refer to Software - Jedi Service Tool - Section 1.0 Jedi Service Software User Guide). 2.) Reapply power and verify that the 8 LEDs on KV Control board are scrolling. 3.) Verify software version - If not, download the software and proceed to Software - Jedi Service Tool - Section 2.0 Service Tool Job Cards. 4.) Calibrate: - 1.9.7 Perform several exposures on both focus in several workstation, with exposure time longer than 12.5 ms. EMC Board 3 Phases 1.9.7.1 Supplies None. Page 256 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.7.2  ILLUSTRATED PARTS LIST Tools 5.5 mm nut driver or socket wrench with ratchet. 1.9.7.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.7.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.7.5 Personnel 1 person. 1.9.7.6 Time 45 minutes. 1.9.7.7 Disassembly Remove the AC/DC Unit 1.) On the top of the generator, disconnect the connectors J1 and J2 1 . 2.) On the support plate, unscrew connectors screws in order to release the 2 power cables coming from the AC/DC Unit 2 . Chapter 13 Illustrated Renewal Parts Page 257  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 3.) Disconnect the ground cable 3 . 4.) Remove the four 5.5 mm screws securing the AC/DC Unit to the support plate 4 . The AC/ DC Unit is now free 5 . Remove the EMC Board 1 3 5 2 1.) Remove ten 5.5 mm hex head screws which retain the cover. Remove that one. 2.) Remove the three nuts 1 securing the phase cables and three screws 2 retaining the EMC board to the rectifier block. 3.) Unscrew nine 5.5 mm hex head screws 3 and remove the EMC Board 4 . 1.9.7.8 Reassembly Reverse the disassembly procedure to reinstall the EMC board. Tighten 5.5 mm screws to torque between 1.5 and 2 N.m (15 to 20 kg.cm). Ensure that U1 screw is tighten to the torque between 1.5 and 2 N.m (15 to 20 kg.cm). Refer to Disassembly 5 . Remount the generator inside the table. 1.9.7.9 Verify Reapply power and verify the presence of 3 phases. Verify that the system functions correctly. Page 258 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.8  ILLUSTRATED PARTS LIST AC/DC 3 PH Mid Power Assembly 1.9.8.1 Supplies None. 1.9.8.2 1.9.8.3 Tools • 5.5 mm socket, with ratchet if possible (to remove cover and board) • 10 mm socket with ratchet (to remove DC and rectifier cables) • Large Philips screw driver (to remove cables from the rectifier block). Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. 1.) Insure that the neon (orange) indicator light on the board has gone out. 2.) Be careful touching components on this board; some become very hot. 3.) To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.8.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.8.5 Note: Disassembly The AC/DC 3 Phases Mid Power Assembly is made up of two main elements: AC/DC Board 3 Phases and Rectifier Block 3 Phases. Remove the AC/DC Unit 1.) On the top of the generator, disconnect the connectors J1 and J2 1 . 2.) On the support plate, unscrew connectors screws in order to release the 2 power cables Chapter 13 Illustrated Renewal Parts Page 259 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST coming from the AC/DC Unit 2 . 3.) Disconnect the ground cable 3 . 4.) Remove the four 5.5 mm screws securing the AC/DC Unit to the support plate 4 . The AC/ DC Unit is now free 5 . Remove the AC/DC Board 1.) Remove fourteen 5.5 mm hex head screws which retain the cover. Remove that one. 2.) Remove the two DC cables fastened with 10 mm nuts on the board 1 . 3.) Remove two screws retaining the AC/DC board to the rectifier block 2 . 4.) Remove seven 5.5 mm hex head screws 3 and lift out the AC/DC Board 4 . Page 260 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST Remove the Rectifier Block 1.) The Rectifier Block 1 appears after removing the EMC Board (refer to 1.9.7 EMC Board 3 Phases) and the AC/DC Board. 2.) With the Allen key 3 mm, unscrew the 2 screws 2 holding the rectifier to the chassis and remove the block. 1.9.8.6 Reassembly 1.) Reverse the disassembly procedure to reinstall the AC/DC 3 PH Mid Power Assembly and the EMC Board. 2.) Tighten the 10 mm cable retaining nuts to 3 N.m (30 kg.cm), and the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Ensure cable terminals are repositioned as noticed before. Verify that the + and - DC Bus cables are not reversed to prevent damage to the Inverter (Refer to section Disassembly 1 . The Rectifier Block has to be placed with the two poles in regard of the AC/DC Board (Refer to section Disassembly 1 . Be careful to preserve the special grease that is spread between the Rectifier Block and the chassis. This grease, called: Conductive Surface Compound, provides both thermal and electrical conductivity that is important in reducing failure of the rectifier. 3.) Remount the generator inside the table. 1.9.8.7 Verify Reapply power and verify that the system functions correctly. Chapter 13 Illustrated Renewal Parts Page 261 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.9  ILLUSTRATED PARTS LIST Inverter Coil Mid Power Assembly 1.9.9.1 Supplies None. 1.9.9.2 1.9.9.3 Tools • 5.5 mm nut driver or socket wrench with ratchet. • 3 mm Allen wrench. • 13 mm socket with ratchet. Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.9.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.9.5 Personnel 1 person. 1.9.9.6 Time 2 hours. 1.9.9.7 Disassembly RESPECT THE CAUTION RELATING TO DANGEROUS VOLTAGE. Remove the Auxiliary Unit and the Interface Unit Remove these Units as described in Disassembly / Reassembly procedure for 1.9.4 Inverter MidPower Assembly. Remove the AC/DC Unit and the support plate Remove the AC/DC Unit and the support plate as described in 1.9.4 Inverter Mid-Power Assembly. THE POWER UNIT IS NOW FREE BUT IT WEIGHTS 30 KILOGRAMS (66 POUNDS). DO NOT TRY TO LIFT IT WITHOUT ASSISTANCE. Page 262 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the Inverter Coil Mid Power Assembly 2 1 3 A 1.) On the Power Unit, remove the 5.5 mm hex head screws 1 which secure the L-shaped EMC cover panel 2 ; remove this one. 2.) With a 10 mm socket wrench with ratchet 3 , remove the three hex head screws 4 securing the cables Q100C, Q100E and Q200C on the Inverter Mid Power Assembly. 7 7 5 6 6 3.) Remove the 10 mm screw 5 on the left current transformer Ti1/40 pass through, top of the Capacitor assembly. Retain the washers and release the cable. Chapter 13 Illustrated Renewal Parts Page 263 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 4.) Disconnect the two cables linking coils to capacitors at right and left 6 Use a socket wrench to remove screws. 5.) On each side 7 , remove one 5.5 mm screw holding the coils support. 6.) Remove the Inverter Coil assembly 8 . 8 1.9.9.8 Reassembly 1.) Present the new Inverter Coil assembly and mount one 5.5 mm hex head screw on each side of the frame to hold the Coil assembly (refer to 1.9.9 Inverter Coil Mid Power Assembly removed 7 . Tighten to torque between 1.5 to 2 N.m (15 to 20 kg.cm) 2.) Remount all cables that were removed. a.) Remount the three Coil cables on the Inverter Mid Power Assembly (IGBTS) with three screws 1 . There is a locking washer between the screws and the cable. Tighten firmly to torque 3 N.m (30 kg.cm). RESPECT THE ORIENTATION OF THE CABLES TO THE IGBTS CONNECTIONS TO AVOID CABLE CONTACT WITH TOP COVER. b.) With the 10 mm screw, with flat and lock washer, remount the remaining cable from the right coil (of the Coil assembly) onto the upper left current transformer Ti1/40 pass through 2 (refer to section Disassembly 5 . Page 264 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 Tighten firmly to torque 3 N.m (30 kg.cm). c.)  ILLUSTRATED PARTS LIST Using a socket wrench, connect the two cables linking coils to capacitors at right and left (refer to section Disassembly 6 . Tighten to torque between 1.5 to 2 N.m (15 to 20 kg.cm). 3.) Refer to Disassembly / Reassembly procedure for 1.9.4 Inverter Mid-Power Assembly. 1.9.9.9 Verify It is recommended to perform the “No load HV“ diagnostics test. “INVERTER GATE” and “INVERTER in Short Circuit ” diagnostics are not pre-requested. Verify correct operation on the whole application range. 1.9.10 Capacitor Inverter Assembly 1.9.10.1 Supplies None. 1.9.10.2 1.9.10.3 Tools • 5.5 mm nut driver or socket wrench with ratchet. • 10 mm allen wrench. • 13 mm socket with ratchet. Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. ENSURE THERE IS NO VOLTAGE ON THE DC BUS CABLE. 1.9.10.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. Chapter 13 Illustrated Renewal Parts Page 265  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.10.5 ILLUSTRATED PARTS LIST Personnel 1 person. 1.9.10.6 Time 3 hours. 1.9.10.7 Disassembly RESPECT THE CAUTION RELATING TO DANGEROUS VOLTAGE. Remove the Auxiliary Unit and the Interface Unit Remove these Units as described in 1.9.4 Inverter Mid-Power Assembly. Remove the AC/DC Unit and the Support Plate Remove the AC/DC Unit and the support plate together as described in 1.9.4 Inverter Mid-Power Assembly. THE POWER UNIT IS NOW FREE BUT IT WEIGHTS 30 KILOGRAMS (66 POUNDS). DO NOT TRY TO LIFT IT WITHOUT ASSISTANCE. Remove the Capacitor Inverter Assembly 2 1 1.) On the Power Unit, remove the 5.5 mm hex head screws 1 which secure the L-shaped EMC Page 266 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST cover panel 2 ; ; remove this one. 3 2.) Remove the cable from connector J1 3 on the Gate Command Board. 3.) Disconnect the Filament cable J3 4 from the HV Tank. 6 5 8 6 8 4 7 4.) Remove the 10 mm 5 and 13 mm screws 6 on the top side , and the 13 mm screws 7 on the lower side of the Capacitor assembly. Release the cables. 5.) Remove the four left and right 5.5 mm screws 8 holding the Capacitor assembly. Chapter 13 Illustrated Renewal Parts Page 267  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 6.) Remove the Capacitor Inverter Assembly 9 . 9 1.9.10.8 Reassembly 1.) Present the new capacitor assembly. 2.) Mount two 5.5 mm hex head screws to hold the Capacitor assembly (refer to section Disassembly 8 ) ). 3.) Reconnect the cable J1 on the Gate Command Board (refer to section Disassembly 3 ). 4.) Attach the shorter cable (parallel coil) on the upper right current transformer (Ti1/100) pass through with a 10 mm screw 1 Tighten to torque 3 N.m (30 kg.cm). and its washers (refer to section Disassembly 5 . 5.) Remount the DC+ cable and the corresponding serial coil cable together on the upper left side of the capacitor assembly with a 13 mm screw and its washers (refer to section Disassembly 6 . Tighten to torque 8 N.m (80 kg.cm). 6.) Remount the DC- cable and the corresponding serial coil cable together on the upper right side of the capacitor assembly with a 13 mm screw and its washers (refer to section Disassembly 6 . Tighten to torque 8 N.m (80 kg.cm). 7.) Remount the remaining serial coil cable to the upper left current transformer (Ti1/40) pass through with a 10 mm screw 1 to torque 3 N.m (30 kg.cm). and its washers (refer to section Disassembly 5 . Tighten 8.) Run the ”INVERTER IN SHORT CIRCUIT” diagnostic: Page 268 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST HV TANK PRIMARY CABLES ARE DISCONNECTED AND ISOLATED. Note: Connect the short circuit cable (included in the first aid kit) between the left capacitor and the central capacitor (see picture in ”Inverter In Short Circuit diagnostics”). a.) Tighten one extremity of the short circuit on the left capacitor with a 13 mm screw and its washers. Tighten to torque 8 N.m (80 kg.cm). b.) Mount the longer wire (Parallel Coil) and the other extremity of the short circuit on the central capacitor (C3UF) with a 13 mm screw and its washers. Tighten to torque 8 N.m (80 kg.cm), Use the illustration below to check the connections are right: Parallel Coil Q100C Q200C C C Q100E E Inverter Assembly E Coil Assembly + + DC Ti1/40 Ti1/100 - - DC Capa Assembly SHORT CIRCUIT c.) C3UF Reassemble the Power Unit with AC/DC Unit, Interface Unit and Auxiliary Unit (refer to 1.9.4 Inverter Mid-Power Assembly). d.) Run “inverter short circuit diagnostics”. 9.) After ”INVERTER SHORT CIRCUIT” diagnostics, disassemble the Auxiliary Unit and the Interface Unit (see section Disassembly). Remove the short circuit cable. 10.) On the central capacitor (C3UF), attach together the two flat wires of the primary coils of the HV transformer that have a white ring 2 and the longer wire of Parallel Coil with a 13 mm Chapter 13 Illustrated Renewal Parts Page 269 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 screw and its washers. Tighten to torque 8 N.m (80 kg.cm).  ILLUSTRATED PARTS LIST 2 3 3 11.) Mount the two remaining flat cables 3 from the HV Tank with 13 mm screws and their washers underneath the capacitor assembly, one on the left side, one on the right side. 12.) Reconnect the Filament cable J3 on the HV Tank (refer to section Disassembly 4 . 13.) Mount the two last remaining 5.5 mm hex head screws on the left and right side of the frame (refer to section Disassembly). Tighten to torque 1.5 to 2 N.m (15 to 20 kg.cm). 14.) Reassemble the Power Unit. Mount it with the AC/DC Unit, the Interface Unit and the Auxiliary Unit on the support plate (Refer to 1.9.4 Inverter Mid-Power Assembly). 1.9.10.9 Verify It is recommended to perform the “No load HV“ diagnostics test. Verify correct operation on the whole application range. 1.9.11 LV Power Supply 3 Phase Board 1.9.11.1 Supplies None. 1.9.11.2 Tools 5.5 mm hex nut driver or socket wrench with ratchet. 1.9.11.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. 1.) Insure that the Neon N1 (orange) indicator light on the LVPS Board has gone out. 2.) Be careful touching components on the LVPS Board. Some become very hot. To protect the circuit boards, do not forget to wear the antistatic bracelet. Page 270 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.11.4  ILLUSTRATED PARTS LIST Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.11.5 Personnel 1 person. 1.9.11.6 Time 15 minutes. 1.9.11.7 Disassembly Remove the Auxiliary Unit 1.) Disconnect the connectors J2 and J3 and the ground cable on the top of the generator 1 . 2.) Remove four 5.5 mm hex head securing screws 2 olding the Auxiliary Unit 4 on the support plate 5 . 3.) Disconnect the flat ribbon cable 3 without tearing, between the Auxiliary Unit 4 and the Interface Unit 6 . 4.) Remove the Auxiliary Unit. Chapter 13 Illustrated Renewal Parts Page 271  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the LV Power Supply Board 1.) The Auxiliary Unit being free, unscrew ten 5.5 hex head screws and remove its cover. 2.) Disconnect the 3 cables 1 , 2 , 3 from the LV Power Supply 3 Phases board 4 . 3.) Unscrew the six 5.5 mm hex head screws and remove the LV Power Supply 3 Phase Board 4 . 1.9.11.8 Reassembly Reverse the disassembly procedures to reinstall the LV Power Supply 3 Phases Board. Verify that the following cables are not reversed before power ON (refer to section Remove the LV Power Supply Board: 1.) Cables CF2 (+DC BUS) and CF1 (- DC BUS) 2 . 2.) Cables CF4 (160 V) and CF3 (0 V) 3 . Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Remount the cover. Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Remount the auxiliary unit on the generator support plate. Remount the generator inside the table. 1.9.11.9 Verify Verify that the system functions correctly. Page 272 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.12  ILLUSTRATED PARTS LIST Filament Board 1 INV 1.9.12.1 Supplies None. 1.9.12.2 Tools 5.5 mm hex nut driver or socket wrench with ratchet. 1.9.12.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. 1.) Insure that the Neon DS3 (green) indicator light on the Filament Board has gone out. 2.) Be careful touching components on the Filament Board . Some become very hot. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.12.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.12.5 Personnel 1 person. 1.9.12.6 Time 15 minutes. Chapter 13 Illustrated Renewal Parts Page 273  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.12.7 ILLUSTRATED PARTS LIST Disassembly Remove the Auxiliary Unit 1.) Disconnect the connectors J2 and J3 and the ground cable on the top of the generator 1 . 2.) Remove four 5.5 mm hex head securing screws 2 holding the Auxiliary Unit 4 on the support plate 5 . 3.) Disconnect the flat ribbon cable 3 , without tearing, between the Auxiliary Unit 4 Interface Unit 6 . 4.) Remove the Auxiliary Unit. Page 274 Section 1.0 Illustrated Renewal parts and the  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the Filament Board 1.) The Auxiliary Unit being free, unscrew ten 5.5 mm hex head screws and remove its cover. 2.) Disconnect the ribbon cable . Disconnect 1 between the Filament Board 2 and the connector J2 4 and the LVPS Board 5 3 . 3.) Unscrew the six 5.5 mm hex head screws and remove the Filament Board 1 INV 4 . 1.9.12.8 Reassembly Reverse the disassembly procedures to reinstall the Filament Board 1 INV. Verify that cables CF4 (160 V) and CF3 (0 V) 2 are not reversed before power ON (refer to section Remove the Filament Board). Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Remount the cover. Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Remount the auxiliary unit on the generator support plate. Remount the generator inside the table. 1.9.12.9 Verify Verify that the system functions correctly. Run Heater Function Diagnostics. Chapter 13 Illustrated Renewal Parts Page 275 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.13  ILLUSTRATED PARTS LIST Rotor Board High Speed 1.9.13.1 Supplies None. 1.9.13.2 Tools 5.5 mm hex nut driver or socket wrench with ratchet. 1.9.13.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. 1.) Insure that the Neon DS7 (orange) indicator light on the Rotor Board has gone out. 2.) Be careful touching components on the Rotor Board. Some become very hot. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.13.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.13.5 Personnel 1 person. 1.9.13.6 Time 15 minutes. Page 276 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.13.7 ILLUSTRATED PARTS LIST Disassembly Remove the Auxiliary Unit 1.) Disconnect the connectors J2 and J3 and the ground cable on the top of the generator 1 . 2.) Remove four 5.5 mm hex head securing screws 2 holding the Auxiliary Unit 4 on the support plate 5 . 3.) Disconnect the flat ribbon cable 3 , without tearing, between the Auxiliary Unit 4 and the Interface Unit 6 . 4.) Remove the Auxiliary Unit. Chapter 13 Illustrated Renewal Parts Page 277  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Remove the Rotor Board 1.) The Auxiliary Unit being free, unscrew ten 5.5 mm hex head screws and remove its cover. 2.) Disconnect the ribbon cable 1 between the Rotor Board High Speed 4 and the LVPS Board 5 Disconnect cables CF1 and CF2 2 . 3.) Unscrew two 5.5 mm hex head screws that are in holes 3 below the surface of the board and that secure an IGBT. 4.) Unscrew the eight 5.5 mm hex head screws and remove the Rotor Board High Speed 4 . Be careful to preserve the special grease that is spread between the IGBT and a heat sink under the Rotation Board. This grease, called "Conductive Surface Compound", provides both thermal and electrical conductivity that are important in reducing failure of the IGBT. 1.9.13.8 Reassembly Reverse the disassembly procedure to reinstall the Rotor Board High Speed. Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Ensure that cables are correctly connected. Ensure that marks on the cables match the marks on the board. Remount the cover. Tighten the 5.5 mm hex head screws to 1.5 to 2 N.m (15 to 20 kg.cm). Remount the auxiliary unit on the generator support plate. Remount the generator inside the table. 1.9.13.9 Verify Verify that the system functions correctly. Run Heater Function Diagnostics. Page 278 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.14  ILLUSTRATED PARTS LIST AEC Board 1.9.14.1 Supplies None. 1.9.14.2 Tools 5.5 mm nut driver or socket wrench with ratchet. 1.9.14.3 Safety Precautions BEFORE ANY MANUAL INTERVENTION, ENSURE THE MAIN POWER IS OFF. APPLY LOCK OUT - TAG OUT PROCEDURE FOR YOUR OWN SAFETY WHEN MANIPULATING INSIDE THE EQUIPMENT IS REQUIRED. To protect the circuit boards, do not forget to wear the antistatic bracelet. 1.9.14.4 Prerequisites Remove the generator from the table and put it on its bottom side on the floor or on a work bench. THE WHOLE GENERATOR WEIGHTS 63 KILOGRAMS (139 POUNDS). TWO PEOPLE ARE REQUIRED TO CARRY IT. 1.9.14.5 Personnel 1 person. 1.9.14.6 Time 10 minutes. Chapter 13 Illustrated Renewal Parts Page 279  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 1.9.14.7 ILLUSTRATED PARTS LIST Disassembly Remove the Auxiliary Unit 1.) Disconnect the connectors J2 and J3 and the ground cable on the top of the generator 1 . 2.) Remove four 5.5 mm hex head securing screws 2 holding the Auxiliary Unit 4 on the support plate 5 . 3.) Disconnect the flat ribbon cable 3 , without tearing, between the Auxiliary Unit 4 and the Interface Unit 6 . 4.) Remove the Auxiliary Unit. Remove the AEC Board 1.) After removing the Auxiliary Unit, the Interface Unit appears. Release the flat ribbon cable Page 280 Section 1.0 Illustrated Renewal parts  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 1 , making it sliding along the cover panel 2 of the Interface Unit. 2.) Unscrew twelve 5.5 mm screws that retain the cover panel and remove this one 2 . 3 7 4 8 6 5 3.) Disconnect the flat ribbon cable from J5 3 between the I/F Board RAD 7 and the AEC Board 8 . 4.) Disconnect the connectors J2 4 and J1 5 and Test Points TP1 and TP2 6 on the AEC Board. 5.) Remove the six 5.5 mm screws securing the AEC Board 8 . 1.9.14.8 Reassembly Reverse the disassembly procedure to reassemble the unit. Tighten screws to torque between 1.5 and 2 N.m (15 to 20 kg.cm). 1.9.14.9 Verify Reapply power. Proceed to ”AEC diagnostics” to ensure correct operation. Chapter 13 Illustrated Renewal Parts Page 281 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST Section 2.0 Part Replacement Note: 2.1 Some renewal part need to conduct calibration through console LCD service menu after replacement. Especially for pot and electric board. The menu login passward is 100176. Detector replacement 1.) Removal 1.) System Power Off > Shut down the system. > Switch off the PDU and conduct LOTO. > Position the detector component to an appropriate position convenient for uninstalling the left part of detector housing(5461879) and detector. 2.) Uninstall the detector > Insert the pin hydrant through the column and install the fixed plate for safety concern. For Brivo XR575P, the column cover need to be removed firstly. Pin hydrant fixed plate Page 282 > Uninstall the back cover of the detector housing and relax the four clips. > Uninstall the left part of detector housing, and disconnect the E-stop cable. Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST Figure 13-5 Uninstall the left part of the detector housing > Disconnect the cables connected with detector(5428934, 5428629, 5428859) > Remove the block on the slide > Now you can remove the old detector. 2.) Reinstall the new detector. 1.) Reinstall the new detector according to the Chapter 5 - System Hardware Installation -Section 2.0 Detector Housing Component 2.) Install the left part of the detector housing and connect the E-stop cable. 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.2 Grid-in Switch in Detector Housing 1.) Removal 1.) System Power Off > Shut down the system. > Switch off the PDU and conduct LOTO. > Position the detector component to an appropriate position convenient for uninstalling patient barrier(5447916) on detector housing. 2.) Uninstall the Grid-in Switch > Remove the patient barrier on detector housing. Chapter 13 Illustrated Renewal Parts Page 283 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 > Put out the receptable plug from the Grid-in switch. > Remove the Grid-in switch on detector housing.  ILLUSTRATED PARTS LIST 2.) Reinstall the new Grid-in switch. 1.) Reinstall the new Grid-in switch to the detector housing. 2.) Connect the receptable plug to the Grid-in switch. 3.) Put back the patient barrier to the detector housing. 4.) Remove LOTO and energize the system. 5.) Clean the site. 2.3 Grid Detent Replacement 1.) Removal 1.) System Power Off > Shut down the system. > Switch off the PDU and conduct LOTO. > Position the detector housing to an appropriate position 2.) Uninstall the Grid detent. Page 284 > Remove the plate with handle on the housing > Remove the top plate on the housing > Disclose the grid detent and screw off it from the housing Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 2.) Reinstall the new grid detent. 1.) Reinstall the new grid detent to the detector housing. 2.) Put back the plates to the detector housing. 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.4 X-Ray Tube/Collimator replacement 1.) Removal 1.) System Power Off > Shut down the system. > Switch off the PDU and conduct LOTO. > Position the tube to an appropriate position convenient for uninstalling the tube and collimator 2.) Uninstall the tube > Uninstall all the tube cover. > Remove the tube cover on anode side and disconnected the anode rotation cable (5428666) > Disconnect the HV cables. > Rotate the tube 180 degrees. > Loosen the two collimator stop plates and remove the collimator.Refer to Chapter 5 - System Hardware Installation-Section 3.0 X-ray Tube and Collimator-3.2 Installation > Now you can remove the old tube. 2.) Reinstall the new tube and collimator Chapter 13 Illustrated Renewal Parts Page 285 GE HEALTHCARE  DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST 1.) Reinstall the new tube and collimator according to the Chapter 5 - System Hardware Installation-Section 3.0 X-ray Tube and Collimator 2.) Install the tube cover. 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.5 Relay on Topbox Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Remove the topbox front cover 4.) Draw out the Relay from the box 2.) Reinstall 1.) Insert the new relay 2.) Install back the front cover 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.6 Detector Power Supply Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Seperate the single topbox from the top plate. 4.) Screw off the cables connected in the power supply. 5.) screw off the supply from the box. Page 286 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 2.) Reinstall 1.) Install the new power supply 2.) Install back the topbox 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.7 150w Power Supply 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Seperate the single topbox from the top plate. 4.) Screw off the cables connected in the power supply. 5.) screw off the supply from the box. Chapter 13 Illustrated Renewal Parts Page 287 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 2.) Reinstall 1.) Install the new power supply 2.) Install back the topbox 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.8 Configured Servo 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Seperate the single topbox from the top plate. 4.) move out the cables connected in the Servo. 5.) screw off the servo from the box. 2.) Reinstall 1.) Install the new servo supply 2.) Install back the topbox 3.) Remove LOTO and energize the system. Page 288 Section 1.0 Illustrated Renewal parts  ILLUSTRATED PARTS LIST GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 4.) Clean the site. 2.9  ILLUSTRATED PARTS LIST Motor Component on Column Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Uninstall the potentiometer in the component. 4.) Screw off all the nuts and bolt to take the component out. 2.) Reinstall 1.) Put new motor component on the top column 2.) Install back all the screws and bolts 3.) Install back the potentiometer 4.) Remove LOTO and energize the system. 5.) Clean the site. 2.10 Console LCD on Tube Support Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Remove the tube cover 4.) Screw off the LCD cover 5.) Draw off the connected cable 6.) Screw off the circuit board from the cover. Chapter 13 Illustrated Renewal Parts Page 289 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 2.) Reinstall 1.) Install the new circuit board 2.) Install back all the covers 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.11 Angle LCD Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Remove the Angle cover 4.) Draw off the connected cable 5.) Screw off the circuit board from the cover. 2.) Reinstall 1.) Install the new LCD 2.) Install back the cover 3.) Remove LOTO and energize the system. 4.) Clean the site. Page 290 Section 1.0 Illustrated Renewal parts  ILLUSTRATED PARTS LIST GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 2.12  ILLUSTRATED PARTS LIST Spine PCB board Replacement(5430961) 1.) Removal 1.) move the detector housing to the end of the Arm. 2.) Shut down the system. 3.) Switch off the PDU and conduct LOTO. 4.) Remove the back cover of the Arm in detector housing side. 5.) Screw off the spine board. 2.) Reinstall 1.) Install the new board 2.) Install back the cover 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.13 Spring on Tube Support Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Insert the pin hydrant though the column and install the fixed plate for safety concern. For Brivo XR575P, the column cover need to be removed firstly. Chapter 13 Illustrated Renewal Parts Page 291  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST Pin hydrant fixed plate 4.) Tied up a cable tie around the spring 5.) Draw off the spring by pliers 2.) Reinstall 1.) Install the new spring 2.) Tied up a cable tie around the spring 3.) Hold the cable tie by plier and draw the spring to the handle under the same way. 4.) Remove LOTO and energize the system. 5.) Clean the site. 2.14 PDU Unit Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Uninstall the PDU Page 292 > Demount PDU cover. > Disconnect the cables connected on the PDU IF board and remove the IF board. > Disconnect the system power cable and groud cable. > Disconnect the Door Light connection beween PDU and Jedi. Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST > Disconnect Door interlock Cable between PDU and IF board. > Remove old PDU from the tray by remove the fix screws. 2.) Install 1.) PDU Install 2.15 > Demount PDU cover. > Install the PDU IF board on the new PDU. > Connect the cables to the IF board according to Chapter 5 - System Hardware Installation-Section 5.0 Cabinet Electrical Connections > Connect and route System Power Cable according to Chapter 5 - System Hardware Installation-Section 5.0 Cabinet Electrical Connections > Connect and route the Door Light connection at PDU according to Chapter 5 System Hardware Installation-Section 5.0 Cabinet Electrical Connections > Connect and route Door interlock Cables according to Chapter 5 - System Hardware Installation-Section 5.0 Cabinet Electrical Connections > Install the PDU cover. Collimator Lamp (5136302) Replacement 1.) Power off. 2.) Loose the fix knob, and rotate the collimator to the location which is convenient for operation 3.) Demount the back cover with screws. Chapter 13 Illustrated Renewal Parts Page 293 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST Figure 13-6 Collimator Lamp Uninstallation 4.) Replace the collimator lamp. 5.) Remount back cover, rotate collimator back, and tighten the fix knob. Note: 2.16 The collimator uses a special Collimator lamp.When the collimator lamp burns out it MUST be replaced with the replacement lamp listed in the renewal parts section. Part number 5136302 MUST be used as a replacement lamp. DO NOT use any other lamp as a replacement bulb as X-ray field to Light field alignment may not meet HHS requirements. Spring of U-Arm Rotation Detent Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and Conduct LOTO. 3.) Uninstall the left part of the back cover of the U-Arm 4.) Uninstall the cover of the Rotation gear 5.) Tied up a cable tie around the spring 6.) Draw off the spring by pliers 2.) Reinstall 1.) Install the new spring 2.) Tied up a cable tie around the spring Page 294 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 3.) Draw the cable tie to install the spring on the detent.  ILLUSTRATED PARTS LIST 4.) Remove LOTO and energize the system. 5.) Clean the site. 2.17 SID Brake Replacement(5447915/5491345) 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and Conduct LOTO. 3.) Remove off the back cover of U-Arm on the housing side. 4.) Screw off all nuts and the bolt and take out the brake 2.) Reinstall 1.) Install the new brake 2.) Install all the covers. 3.) Remove LOTO and energize the system. 4.) Clean the site. Chapter 13 Illustrated Renewal Parts Page 295 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 2.18 Brake on Column Top Replacement (5453213) 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and Conduct LOTO. 3.) Remove off the top cover of U-Arm on the housing side. 4.) Screw off all nuts and the bolt and take out the brake 2.) Reinstall 1.) Install the new brake 2.) Install all the covers. 3.) Remove LOTO and energize the system. 4.) Clean the site. 2.19 Brake in Angle Meter Replacement (5452377) 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and Conduct LOTO. 3.) Remove the angle meter cover and appear the brake. 4.) Screw off the cables cover on the back of U-Arm Page 296 Section 1.0 Illustrated Renewal parts  ILLUSTRATED PARTS LIST GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 5.) Uninstall the the cover of the Rotation gear. 6.) Screw off the cover of back of the brake. 7.) Disconnect the cable. 8.) Screw off the plate to relax the brake. 9.) Relax the screw and take out the brake from the front side. 2.) Reinstall 1.) Install the new brake 2.) Install all the covers. 3.) Remove LOTO and energize the system. 4.) Clean the site. Chapter 13 Illustrated Renewal Parts Page 297 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 2.20  ILLUSTRATED PARTS LIST Steel Rope, safelock and spring Replacement 1.) Removal 1.) Shut down the system. 2.) Switch off the PDU and conduct LOTO. 3.) Discover the top cover of the column. 4.) Remove the two covers on the back of the column. 5.) Remove the cover on the slide. 6.) Put a block inside the bottom of the column to relax the rope afterwards. Page 298 Section 1.0 Illustrated Renewal parts GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 7.) Screw off the tools belt from the slide. 8.) Use the service tool to move the slide up to the top of the solumn.Please leave little distance from the top position as illustrated. 9.) Remove the counterweight from the column. Chapter 13 Illustrated Renewal Parts Page 299 GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 10.) Remove off the steel rope. 11.) Remove off the safelock or spring on the safelock. Page 300 Section 1.0 Illustrated Renewal parts  ILLUSTRATED PARTS LIST GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7  ILLUSTRATED PARTS LIST 2.) Reinstall 1.) Reinstall the spring, steel rope and safelock. 2.) when install the safelock, you need to use a tool to remove the safelock off from the rack inside the slide. 2.21 DAP meter replacement 1.) Remove off the old DAP meter from the collimator and install the new one on it. 2.) Connect the DAP meter power cable to DC24V power in the topbox. Chapter 13 Illustrated Renewal Parts Page 301  GE HEALTHCARE DIRECTION 5429575-CA-1EN, RIVISION 7 ILLUSTRATED PARTS LIST This page is intentionally left blank. Page 302 Section 1.0 Illustrated Renewal parts  IHE GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Chapter 14 Integrating the Healthcare Enterprise (IHE) Integration Statement Section 1.0 - Introduction 1.1 Overview This IHE Integration Statement describes the intended conformance of this GE product with the IHE Technical Framework. The IHE Technical Framework defines a subset of the functional components of the healthcare enterprise, called IHE Actors, and specifies their interactions in terms of a set of coordinated, standards-based transactions. These transactions are organized into functional units called Integration Profiles that highlight their capacity to address specific clinical needs. Users familiar with these concepts can use Integration Statements as an aid to determine what level of integration this product supports with other systems and what clinical and operational benefits such integration might provide. Other GE Integration Statements as well as further information on IHE may be found on Internet at: ge.com/ihe 1.2 Important Remarks The use of these IHE Integration Statements, by itself, it is not sufficient to ensure that interoperation will be successful. The user needs to proceed with caution and ensure that a qualified systems' integration (such as that provided by GE's IT Professional Services) address at least four issues: • Integration - The integration of any system into an integrated department or enterprise requires an analysis of the applications requirements. The design of a solution that integrates GE systems with non-GE systems is the user's responsibility and should not be underestimated. Special care should be exercised in defining the expected workflow, the special conditions, and the clinical practice to be supported to ensure a safe and effective operation. • Validation - Testing the complete range of possible interactions between any GE system and non-GE system, before the integration is declared operational, should not be overlooked. Therefore, the user should ensure that any non-GE provider accepts full responsibility for all validation required for their connection with GE systems. This includes the accuracy of the data once it has crossed the interface and the stability of the data for the intended applications. Such a Chapter 14 - Integrating the Healthcare Enterprise (IHE) Integration Statement Page 303  IHE GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 validation is required before any clinical use (diagnosis and/or treatment) is performed. • Future Evolution - GE understands that the IHE Technical Framework and the underlying communication standards will evolve to meet the user's growing requirements. GE is actively involved in the development of the IHE Technical Framework and the underlying standards.Such evolutions may require changes to already installed systems. In addition, GE reserves the right to discontinue or make changes to product features including those reflected by this IHE Integration Statement. The user should ensure that any non-GE system that connects with GE systems also plans for the future evolution of IHE. Failure to do so will likely result in the loss of function and/or connectivity as the IHE Integration profiles evolve and GE Products are enhanced to support these changes. Section 2.0 - IHE Integration Statement General Electric -IHE Integration Statement Date: NOV 04 2012 Vendor Product Name Version GE Healthcare Galaxy Brivo XR575 All This product implements all transactions required in the IHE Technical Framework to support the IHE Integration Profiles, Actors and Options listed below: Integration Profiles Implemented Actors Implemented Scheduled Workflow Acquisition Modality Patient Information Reconciliation Acquisition Modality Options Implemented Broad Worklist Query Patient Based Worklist Query None Internet address for GE Healthcare IHE information:ge.com/ihe Links to Standards Conformance Statements for the Implementation HL7 Not Applicable DICOM ge.com/dicom Links to general information on IHE In North America: www.rsna.org/ihe www.himss.org/ihe Page 304 In Europe: www.ihe-europe.org Section 1.0 - - Introduction In Japan: www.jira-net.or.jp/ihe-j GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  DIAGNOSTICS Chapter 15 Diagnostic and Troubleshooting Section 1.0 Troubleshooting 1.1 Using the Enhanced Error Messages Enhanced error messages are available to GEHC personnel, when the GEHC restricted service key is installed. The enhanced error messages contain additional information not found in the system error log during normal system operation or available to the normal user. These enhanced error messages contain additional information that aid in fault isolation and choosing the proper corrective action. With the service key installed, error messages in the system error log area automatically linked to the enhanced messages. The complete set of enhanced error messages is contained in a single HTML file located on the same CD-ROM as the service key. When the CD is installed, you'll notice that error numbers in the system log are underlined to indicate a hyper-link to the enhanced message. You use the mouse to clink on the links. To utilize the enhanced error messages: 1.) Close the SUIF, if it’s open. Applications can only mount the CD-ROM path in Linux, when the SUIF is closed. 2.) Install the service key CD-ROM into the CD-ROM drive and close the drive. 3.) Launch the SUIF. 4.) Using the mouse, click on the Error Log Tab 5.) Using the mouse, left click on an error number of interest to you. This will launch a browser and allow you to see the enhanced error message. 6.) To exit, click on the SUIF button and remove the service key CD-ROM. 1.2 1.2.1 Workstation Bar Code Reader The Bar code reader automatically performs self-tests whenever initially turned on. If it’s not functioning properly, review the following sections to try to isolate the problem or replace the reader. The barcode reader is not user serviceable (except for cleaning) and must be replaced as a whole unit (FRU). If you aren’t sure what programming options have been set, or if you want the factory default settings restored, scan the “Factory Default Settings”. 1.2.1.1 Is the power on? Is the red illumination beam on? If the red illumination beam isn’t illuminated, check that: 1.) The cable is connected properly. 2.) The host system power is on (if external power isn’t used). 3.) The trigger works. Chapter 15 - Diagnostic and Troubleshooting Page 305  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2.1.2 DIAGNOSTICS Is the scanner having trouble reading your symbols? If the scanner isn’t reading symbols well, check that the symbols: 1.) Aren’t smeared, rough, scratched, or exhibiting voids. 2.) Aren’t coated with frost or water droplets on the surface. 3.) Are enabled in the scanner or in the decoder to which the scanner connects. 1.2.1.3 Is the bar code displayed but not entered? The bar code is displayed correctly, but you still have to press a key to enter it (the / key or the key, for example). You need to program a suffix. See the reader’s user guide on setting up suffixes. 1.2.1.4 The scanner won’t read your bar code at all. 1.) Scan sample bar codes in the user guide. If the scanner reads the sample bar codes, check that “your “bar code is readable. 2.) If the scanner still can’t read the sample bar codes, scan “All Symbologies”. 1.2.2 Console When power is first applied to the console, firmware inside the unit turns ON all of the LEDs for 2 seconds and then turns them OFF (LED ON sequence). If the LEDs don’t turn ON and OFF after power-up, the console needs to be replaced. 1.2.3 LCD Monitor 1.2.3.1 1.2.3.2 1.2.3.3 No Picture • The signal cable should be completely connected to the display card/computer. • The display card should be completely seated in its slot. • Check the Vacation Switch should be in the ON position. • Front Power Switch and computer power switch should be in the ON position. • Check to make sure that a supported mode has been selected on the display card or system being used. • Check the monitor and your display card with respect to compatibility and recommended settings. • Check the signal cable connector for bent or pushed-in pins. • Check the signal input, “INPUT 1” or “INPUT 2”. Power Button Does Not Respond • Unplug the power cord of the monitor from the AC outlet to turn off and reset the monitor, or simultaneously press the RESET and Power buttons. • Check the Vacation Switch on the left side of the monitor. Image persistence Image persistence is when a “ghost” of an image remains on the screen even after the monitor has been turned off. Unlike CRT monitors, LCD monitors’ image persistence is not permanent. To alleviate image persistence, turn the monitor off for as long as an image was displayed. If an image was on the monitor for one hour and “ghost” of that image remains, the monitor should be turned off for one hour to erase the image. Page 306 - GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.2.3.4  DIAGNOSTICS Message “OUT OF RANGE” is displayed Message “OUT OF RANGE” is displayed (screen is either blank or shows rough images only) 1.2.3.5 1.2.3.6 • Image is displayed only roughly (pixels are missing) and OSM? warning “OUT OF RANGE” is displayed: Either signal clock or resolution is too high. Choose one of the supported modes. • OSM warning “OUT OF RANGE” is displayed on a blank screen: Signal frequency is out of range. Choose one of the supported modes. Image is unstable, unfocused or swimming is apparent • Signal cable should be completely attached to the computer. • Use the OSM () Image Adjust controls to focus and adjust display by increasing or decreasing the fine total. When the display mode is changed, the OSM Image Adjust settings may need to be readjusted. • Check the monitor and your display card with respect to compatibility and recommended signal timings. • If your text is garbled, change the video mode to non-interlace and use 60Hz refresh rate. LED on monitor is not lit (no green or amber color can be seen) Power Switch should be in the ON position and power cord should be connected. 1.2.3.7 1.2.3.8 1.2.3.9 Display image is not sized properly • Use the OSM Image Adjust controls to increase or decrease the Coarse total. • Check to make sure that a supported mode has been selected on the display card or system being used. No Video • If no video is present on the screen, turn the Power button off and on again. • Make certain the computer is not in a power-saving mode (touch the keyboard or mouse). On-Screen Manager OSM Trademarks apply to appropriate countries. (On-Screen Manager) control buttons on the front are used to basic monitor functions. They function as follows: 1.3 • To access OSM menu, press any of the control buttons (, –, +). • To change signal input, press the button. OSM must be closed in order to change signal input. Soft Reset of Software on PC Problem: System software has hung on the PC. Chapter 15 - Diagnostic and Troubleshooting Page 307 GE HEALTHCARE  DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS Solution/Work-Around: There is a hot-key that will allow you to do a soft reset of the PC Software. After software reset, exposures can be taken. The procedure for doing a soft reset follows: 1.) Press + . Note: Only a hard reset will properly reset the entire system. 2.) When the GUI below appears, select [OK]. 3.) The Software will shutdown and restart at the HIPPA Login screen, in about 60 seconds. 1.4 Engineering Toolkit Problem: There are no software tools available if the PC hangs. Solution/Workaround: There is a hot-key that will allow you to open an engineering user interface to help diagnose an issue. Here is the procedure to access this engineering GUI: 1.) Press ++ . 2.) The following GUI will popup on the screen your mouse cursor is currently on (Left or Right): 3.) Choose one of the following actions: Page 308 - GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.5  DIAGNOSTICS QAP Results and Images The QAP results files and images can be found in the following location: /export/home/insite/server/htdocs/suif/iq/en/iqst/ where, Receptor Type = Table or WS The following is an example of an InSite session: relay:relay 192.227.61.116 23 Raptor Firewall Secure Gateway. GEHC/CTT Linux 4.3.8 Kernel 2.6.7-2.2smp on an i686 login: insite Password: Last login: Tue Mar 1 09:53:58 from 150.2.12.163 Welcome InSite [insite@magic ~]$ su - xruser Password: (Consult your Administrator for Password information) [xruser@magic xruser]$ cd /export/home/insite/server/htdocs/suif/iq [xruser@magic iq]$ pwd /export/home/insite/server/htdocs/suif/iq [xruser@magic iq]$ cd en [xruser@magic en]$ cd iqst [xruser@magic iqst]$ ls Table WS [xruser@magic iqst]$ cd Table Chapter 15 - Diagnostic and Troubleshooting Page 309  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 [xruser@magic Table]$ ls DIAGNOSTICS 200502280838P_Details.txt 200502280838P_iqst_Bad_Pixel.jpg 200502280838P_iqst_Conversion_Factor.jpg 200502280838P_iqst_Global_BNU.jpg 200502280838P_iqst_Local_BNU.jpg 200502280838P_iqst_Noise_Power_Spectrum.jpg 200502280838P_iqst_Physical_Test.jpg 200502280838P_iqst_Relative_DQE.jpg 200502280838P_iqst_SNR_Non_Unif.jpg 200502280838P_iqst_System_MTF.jpg 200502280838P_IQST.txt 200502280838P_QAP.txt Image200502280838Pcomposite.img Image200502280838Pflatfield1.img Image200502280838Pflatfield2.img Imagetimestamp timestamp Each time the QAP is run, 15 files are created. Three text result files (details.txt, IQST.txt, and QAP.txt), nine graphical result jpg file types, and three image files (two flat field and one composite). The only image files retained are for the last two QAP runs. In addition, there are two time stamp files “timestamp” which documents when the QAP tests ran, and “Imagetimestamp”, which documents when the last two sets of QAP images were created). Page 310 -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 1.6 DIAGNOSTICS Software Toubleshooting 1. How to find the boot failures? System boot has failed, i.e. UI did not come up or buttons are disabled after boot. Following are the steps. S olutions: ‰ Open /magichome/xruser/log/sysError.log ‰ Go to the end of log file. [if you are using vi editor, press shift + g] ‰ Look for the last 3400005 error code “The system is booting” ‰ Look through all the errors till end. Especially look for “Timed out” ‰ Take snapshot and sent to IB. Sample: 5000011 – “System Boot Failed: Timed Out waiting for boot to complete, the system has to be Reset” "ActorsNot ready : XRBeamForm “ As indicated by error log, XRBeamForm actor is not ready. 2. How to find the appsetup failures? System appsetup failed and system displayed a message “Protocol not available”. Following is the method. S olution: ‰ Open /magichome/xruser/log/sysError.log ‰ Go to the end of log file. [if you are using vi editor, press shift + g] ‰ Look for the last error. Sample 1: 617,2008-03-27,01:53:15:015,"VEN",400011, Time out.,2222,WR,DEFAULT, SysCntrl, control, Software problem,1,1,1, Time out while in CHANGE_ACTIVE waiting for XRSysProxy ,XRAppDirSM.cpp,907 This indicates that SysProxy actor has failed the appsetup at CHANGE_ACTIVE_OPMODE phase. Sample 2: 147,2008-03-02,05:09:46:298,"VEN",400011, Time out.,2222,WR,DEFAULT, SysCntrl, control, Software problem,1,1,1, Time out while in OPMODE_CONFIG waiting for XRTechMgr ,XRAppDirSM.cpp,907 This indicates that TechMgr actor has failed the appsetup at OPMODE_CONFIGURE phase. Chapter 15 - Diagnostic and Troubleshooting Page 311  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 3. What to do if System crash popup? System displayed a popup saying “System Crashed”. Following is the method. ƒ S tep 1: You need to find out when exactly system crash has happened and who crashed. ‰ Open /magichome/xruser/log/sysError.log ‰ Go to the end of log file. [if you are using vi editor, press shift + g] ‰ Look for the last error to find which actor crashed Sample: 5000051 480,2008-03-23,05:01:17:804,"VEN",5000051, AFRF has detected fault in the system,2222,DO,DEFAULT, SysCntrl, SysCntrl, Software_Problem,2,1,1, Component XRImDet has been classified as Severity 2. Restarting the component with notification to Fault Notification Consumers.,../subsysmgr/subsysmgr/FaultRecovery.cpp,433 This indicates that XRImDet actor has crashed. ƒ Step 2: Find the corresponding core file generated for the crashed actor. ‰ ‰ ‰ ‰ cd /magichome/xruser/bin/ su root [passwd is #superxr] ls –lrt core.* file core.xxxx ƒ Step 3: take and send snapshot and this core file to IB. 4. How to find the exposure failures? System exposure failed and system displayed a message or did not give a digital image. Following is the method. ‰ Open /magichome/xruser/log/sysError.log ‰ Go to the end of log file. [if you are using vi editor, press shift + g] Or match the time stamp find out the right time error has happened in the log. ‰ Look for the last error 200013 S ample 1: 582,2008-03-26,07:22:20:252,"VEN",200013, Time out while waiting for an event or an actor to respond.,2222,WR,DEFAULT, SysCntrl, control, Software Problem RAD,1,1,1, Time out while in EXECUTE_START_SEQ waiting for XRTechOpt XRTechMgr with opmode DigitalLFOVStandardAOP,XRAcqSyncSM.cpp,1180 This indicates that TechOpt and TechMgr actor has failed the exposure at START_SEQUENCE phase. Sample 2: ‰ Similar error can occur in the START_PREPARE phase also. 52,2008-02-27,08:39:17:225,"VEN",200013, Time out while waiting for an event or an actor to respond.,2222,WR,DEFAULT, SysCntrl, control, Software Problem RAD,1,1,1, Time out while in START_PREP waiting for XRImDet with opmode DigitalLFOVStandardAOP,XRAcqSyncSM.cpp,1180 6/ GE Title or job number / 9/11/2017 Page 312 -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 5. How to use system error logs? For any issues, first place to look is /magichome/xruser/log/sysError.log. This can give right pointers to following issues. ‰ Boot failures ‰ Appsetup failures ‰ Exposure failures. ‰ Any other system failures such as crash, etc. S ample 1: This also find out partial failures in the system. Eg: 624,2008-03-27,02:09:27:352,"VEN",3600105, Config Cache error,2222,DO,DEFAULT, SysCntrl, control, Check config cache value,1,1,1, Could not get VASite value. Assuming NO,XRTechMgr.cpp,757 The above error indicates the error in accessing a config value by techmgr actor. Note that 36 (starting number of error code)) is the actor id of the techmgr actor. Sample 2: 593,2008-03-26,07:28:19:299,"VEN",1600140, Aborting Image Processing for the specified frame ,2222,DO,DEFAULT, XRImProc, Constructor, 1. Retry the operation 2. Reset the operation and try again. 3. Call service if problem persists.,1,0,1, Aborting Sequence : 1,XRImProc.cpp,4002 Here 16( starting number of the error code) is actor Id of the ImProc. This indicates ImProc is responsible for this error. 7/ GE Title or job number / 9/11/2017 6. How to create a RDA report? RDA: Reliability Data Analyzer 1) Telnet to the Magic PC with the xruser and then switch to 2) cd /magichome/xruser/machineDB/scripts/ root ./genReliReport.sh Choose an option to generate RDA report 1. Current Session (Enter 1) 2. Specify Start and End Time (Enter 2) 3. Last 24 Hrs (Enter 10) 4. Last 1 Hrs (Enter 11) Enter Your Choice: 3) The RDA reports are stored at /enggdata/Reports/ with the HTML format. A sample file name is looks like: PrintableReport_10_TestSystem_200704112326_1176305211.html The choice entered is 10 YYYYMMDDHHMM Seconds 4) Ftp this file to RDA server or your local labtop for further analys. Chapter 15 - Diagnostic and Troubleshooting Page 313  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 7. How to start Engineering Tool Box? 1 PDNHVXUH0DJLFZRUNVWDWLRQLVRQWKHDSSOLFDWLRQ8,LIQRW ,ILWLV=SUHVVಯ&WUO$OW)”WRVZLWFKWRDSSOLFDWLRQ8,,ILWLV=SUHVV &WUO$OW)WRVZLFKWRDSSOLFDWLRQ8,$QGWKHQpress “Ctrl + Shift + F5” There are 6 buttons in the Engineering Tool Box: o recording tool o X-terminal o DICOM header tool for a selected image o A system snapshot tool o A burn the snapshot to cd tool o A softreset (restart browser) tool o And an exit button 9/ GE Title or job number / 12/31/2012 8. How to take a snapshot? ¾Two methods could be employed to take a snapshot: 1). PUHVVWKHWKLUGLFRQRIFDPHUD Engineering Tool Box, LQWKHSRSXSWH[WOLQH LQSXWWKHQDPHRIWKLVVQDSVKRWLWLVEHWWHUWRPDNHWKHQDPHZHOOXQGHUVWRRGIRU WKHLVVXHWKHQSUHVV“2.”ZDLWLQJIRUWKHVQDSVKRWILQLVKEHLQJFUHDWHG 2). &RPPDQG OLQHPHWKRG [root@magic ~]$ cd /magichome/xruser/engg [root@magic engg]$ ./collectLogs.sh ¾ $IWHUWKHVQDSVKRWFUHDWHGWKHQHZ]LSILOHRIWKHVQDSVKRWZLOOEHFUHDWHG XQGHUHQJJGDWD6QDSVKRWVVHQGLWWRWKHVQDSVKRWserver via FTP or USB disk, etc. Page 314 -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 8. How to take a snapshot? 1. How to take snapshot when UI hang up: -> Ctrl + Alt+ F1..F6 : switch to console window -> Log in with “xruser”, “4$xray” -> input snapshot name after ran cmd below: cd /magichome/xruser/engg/ ./collectLogs.sh 2 . How to take snapshot when disk full -> “df” to check harddisk space of /magichome partition -> If it’s 100% used, check the path to see which is the biggest folder/file taking the space: cd /magichome du -sm * | sort -> If the biggest one is a folder, enter the folder and run “du -sm * | sort” cmd again, until find the exact abnormal file. -> record the abnormal file/path name, then reset system. -> the unless log files should have been removed automatically. Then take a snapshot for this. GE Titl j b 11 / b / 9. How to handle UI hang up? 1. 2. Take a snapshot first for further investigation. On the Engineering Tool Box, click the Application Reset button to restart X-Ray applications Application Reset 3. If the system still can not work correctly, RESET the system via the Reset button on RCIM Chapter 15 - Diagnostic and Troubleshooting Page 315  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 10. How to handle the file system crash? Sometimes, the Linux file system may crash and cannot start X-Ray applications. The root cause maybe: ƒ unclean shutdown, ƒ unclean umount operations, e.g., failed to umount the USB disk, or ƒ Software bugs from the X-Ray application program itself. The steps to handle this special case are following. ƒ ƒ ƒ ƒ Login with the root’s password #superxr Input “fsck –y” to fix the crashed file system automatically. After above operation done, input “reboot” to restart the Magic PC. Take a snapshot for further investigation on the root cause. 11. How to copy Snapshots from system to USB 1. Plug USB disk into USB port of workstation. 2. Press Ctrl+Shift+F5 to open ENGGUI and open command line window, type cd / enggdata/Snapshots/ in command line. 3. Type ls to list all snapshots. 4. Type cp xxxx /mnt/usbdisk/ to copy selected snapshot into USB disk, xxxx is the name of snapshots 5. Type ls /mnt/usbdisk/ to confirm snapshot copy action is successful. 6. Type superuser su and relate password. 7. Type umount /mnt/usbdisk/ to unmount USB disk, then pull out USB disk from workstation. 1.7 Software Issue 1. How to check software actor status? cd /magichome/xruser/bin/ ‰ csh ‰ source debugEnv.sh ‰ ./Actordebugshell.lnx ‰ source debugShell.tcl ‰ ssm_status This will list all the actors status for the physical subsystem. If any actor boot level or phase is (-1) those actor did not respond with actorReady for EF_PHASE0. Likewise, if some actors are (0) and rest all are at (1), those actors with 0 did not respond to EF_PHASE1. Page 316 -  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 2. How to use sniffer logs? 9 This is one fantastic system generated log which captures all message exchanges and data passed between CORBA entities. 9 All sniffer logs are located in /enggdata/SnifferLogs/sniffer_*.csv. E.g: sniffer_07mar28_020920.csv. There will be many sniffer logs. Identify the right sniffer log of your interest based on the timestamp. 9 You could use sniffer utils to strip “junk” messages and time sort for faster debugging. 9 Look at the following sample sniffer log. T ype,Source,Target,Name,Time,Buffer receive_reply,XRUserIfActor,venus,subscribeDuifEvent,02:09:18.525.431,{return enum DuifStatus=SUCCESS;} receive_reply,XRImProc,INVALID_TARGET,getReference,02:09:15.722.343,{return short=0;} receive_reply,DEFAULT_ACTOR,XRImProc,update,02:09:17.852.216,{return void;} receive_request,XRImProc,INVALID_TARGET,init,02:09:17.728.162,{} receive_reply,XRUserIfActor,venus,registerChannel,02:09:18.505.364,{return ulong=10200;} receive_request,XRUserIfActor,venus,subscribeDuifEvent,02:09:18.525.052,{ulong=70001;ulong=10200;boolean=0;} receive_request,DEFAULT_ACTOR,XRImProc,update,02:09:17.817.462,{ushort=307;boolean=1;} receive_reply,XRUserIfActor,INVALID_TARGET,getReference,02:09:23.725.233,{return short=1;} receive_request,PDUDeviceMgr,venus,subscribeDuifEvent,02:09:14.653.890,{ulong=70002;ulong=10100;boolean=0;} receive_request,DEFAULT_ACTOR,XRImProc,checkStatusReply,02:09:24.930.456,{ushort=1;ulong=0;} receive_reply,XRUserIfActor,venus,subscribeDuifEvent,02:09:18.522.824,{return enum DuifStatus=SUCCESS;} publish,XRSysProxy,N/A,GRID_PRESENCE_CHANGED,02:09:26.591.380,enum GridPresence=GRID_IN receive,N/A,XRDataMgr,GRID_PRESENCE_CHANGED,02:09:26.592.585,enum GridPresence=GRID_IN 9 receive_request 9 receive_reply 9 Publish 9 Receive : Logging on request. I.e. initiation of a CORBA method call. : Logging on reply to the CORBA communication. : indicates the event publication. : indicates that the recipient has got the call. 16 / 3. How to debug a core file? 9 Core files are generated in the system when an executable crashes. 9 A core dump is the recorded state of the working memory of a computer program at a specific time, generally when the program has terminated abnormally (crashed). 9 In practice, other key pieces of program state are usually dumped at the same time, including the processor registers, which may include the program counter and stack pointer, memory management information, and other processor and operating system flags and information. 9 Core dumps are often used to diagnose or debug errors in computer programs. Refer to http://en.wikipedia.org/wiki/Core_dump http://www.ffnn.nl/pages/articles/linux/gdb-gnu-debugger-intro.php Chapter 15 - Diagnostic and Troubleshooting Page 317  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 4. How to calculate MEBEF? o Infantile Failure Rate ¾ Service dispatch analysis on the first 6-months after system installation. o Mean Exam Between Exam Failure (MEBEF) ¾ MEBEF = Total Number of Exams/(Total Number Of Failures + 1). ¾ 840 (exams between L1 failures) @ ME ¾ 1008 @ M3 ¾ MEBEF can be retrieved from RDA report. 18 / GE Title or job number / Question & Answer Q1. .H\XVHIXO/LQX[FRPPDQGLQ*DOD[\V\VWHP? A1. 0ost of the linux cmd are same, except EHORZ changes: ,ILWLV=ZRUNVWDWLRQ -> disable firewall : (root) “/sbin/rcSuSEfirewall2 stop” -> enable VNC : /usr/bin/x11vnc -forever -shared -display :0 -rfbport 5900 -xkb& -> files “ifcfg-eth*” locates at “/etc/sysconfig/network” ,ILWLV=ZRUNVWDWLRQ -> disable firewall : (root) “/VHUYLFHLSWDEOHVVWRS” -> enable VNC : /XVUELQ[YQFIRUHYHUVKDUHG[NEGLVSOD\ -> files “ifcfg-eth*” locates at “/HWFV\VFRQILJQHWZRUNVFULSWV” Q2. How to check FW disconnect from MagicPC? A2. check if continous heartbeat from FW to magicPC each 10 seconds -> cd /enggdata/log -> grep “SHU” sysproxy_n.log (n is the last for sysproxy_*.log) Such msgs each 10s should be seen “SHUTTLE_DATA Choose “Fit to Film” and save. 2. Go to Preferences->Image Management->Auto Print – Edit, click Save button. Section 2 Image print issue: Reprocessed images print displays incompletely or bigger. There are two kinds of reprocess scenarios: z Scenario 1: If taking exposure, then reprocess images, print images. ¾ Solution: Refer to Section 1. z Scenario 2: If opening images in image management window, then reprocess images, print images. ¾ Solution: NEED open RAW image in image management window then reprocess, print images. No issue will occur. Section 2.0 Console LCD Service function 2.1 Login Service Tab Click Service tab on console LCD and input password 100176. 2.2 Positioner Calibration Click Calibration tab and calibrate the system according to the below flow and under the instruction displayed in screen. Note: When initially installing the system, all items should be done. start Page 324 Rotation Calibration Ignore(N) Vertical Motion Calibration Ignore(N) SID Calibration Cal.(Y) Cal.(Y) Cal.(Y) Do 1.1, Then confirm Do 2.1, Then confirm Do 3.1, Then confirm Do 1.2, Then confirm Do 2.2, Then start Do 3.2, Then confirm - Ignore(N) Save or Exit finish GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 2.3  DIAGNOSTICS Hardware Faults Diagnostic Purpose: Conduct the hardware troubleshooting including fans, SID lock(J1),Rotation lock(J2),High LSW and low LSW(J5), Fans(J6),SID Pot(J8), membrace button of detector(J9), membrace button of detector(J10), servo communication(J12). 2.3.1 Manual Diagnostic There will be four items included in the area of [Instruction]. And it needs to manually operate them to check their status. Please follow the below steps to do so. 1.) Conduct the operations under the description in the dialog box of [Instruction] and then press [OK]. - If the status are normal, the [Diag. Result] will appear the word "Normally". - If the status are abnormal, the related fault information will be displayed in the [Diag. Result]. You should continue the step 2 below. Chapter 15 - Diagnostic and Troubleshooting Page 325 GE HEALTHCARE  DIRECTION 5429575-CA-1EN, REVISION 7 DIAGNOSTICS 2.) system image above the page. Touch the circle on the screen to display the details of the faults. Touch the [Pics] button, the trouble part will be displayed Touch the [Back] to return to the Diagnostic screen. Finish all the four items under the same way. 2.3.2 Automatic Diagnostic When the system have other faults other than the four items dispplayed in [Instruction], the fault hints will not only appear in the [Diag. Result] in Diagnosis tab, but also will appear in the [hint] box below of the System tab. 2.4 Hardware Configuration Configuration all items and click [Save] to change the settings. Note: Celling height setting is so important that it will influence the anti-collision function. The Wrong setting will result in the failure of the function. Page 326 - Chapter 16 - - Schematics and Drawings H G F E D C B A 1 IF Board RS232 E-Stop RS232 Pwr Ctrl 9 Detector housing Hospital 3P Power PDU Grid 380Vac Ion-Chamber 2 RS232/RT 0(WKHUQHW E 12VDC Detector 24VDC JEDI (50kW) AEC1 3 Angle Meter LCD Servo 24VDC 12VDC Door RS232/12VDC Spine Board On/Off RS232 3 6:VLJQDO 220VAC 4 4 Note: Only for 575-P 5 09/29/2012 Du Haitao 2 DATE 07/29/2011 Li Bidan MADE BY Xray On lamp 9DF Collimator 1 REV RS232/12VDC 5 Xray Tube - ECR NO. DESCRIPTION 6 6 Initial Draft Release Spine board, Mini PDU, Cabnet updated, Cable connection added Door lock Control LCD REVISIONS HV+/- 2 Rotor 1 OTHER APPR CHECK MADE APPROVALS 220VAC USB E TM RT E E Power-On Reset Hand SW VGA 220VAC Hospital Network Barcode Reader Mouse Keyboard Monitor 8 7 YY/MM/DD TITLE Brivo XR575 8 6575888SCH Galaxy System Block Diagram For electrical scheme with detail Cable interconncetion , please see 5466426SCH E-Stop 57 COM PWR_In Ethernet USB USB PS2 Display card Magic PC 7 1/ 1 SHT/CONT ON 2 REV H G F E D C B A GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Chapter 16 - Schematics and Drawings Section 1.0 System Schematics Page 327 Page 328 Section 1.0 - System Schematics Tube Collimator 5428663 P5 Servo J6 U-ARM Connectivity 5428647 J9 Fan J12 5433031 P1 Door J7 J10 J1 Cabinet J13 Button Console LCD PN:5430979 J8 J2 J6 IF PWA J4 J5 5428661 J3 J2 5428629 5428630 5435324 J4 J5 Door LOCK X-Ray Light PDU 5428638(only for 575P) 5428635(Brivo575P/575) 5428639(Brivo515) 5428665 J1 5432234 5432235 5428636˄Brivo 575P/575) 5428637(Brivo 515) J5 J3 J2 5428632 Spine PWA (in the Arm) PN:5430961 J4 5428931 P2 5428631 J1 AEC1 GND STATOR DC BUS 70ഒ Power Grid in E-stop button 5428645(Brivo575P/575) 5447187(Brivo515) Housing Ion chamber 5429133 P4 motor Detector 5428934 P3 5435322 5435323 Topbox(on column top) PN:5428859 Vertical lock And limit switch 5437495 5428666 5122632(2pcs) or 5393036(2pcs) JEDI Tank U V W GND Rotation LOCK 5428628 5478018 Main power Door lock switch xxx.xxx Note: SID LOCK PN:5447915 J1 TM CONSOLE PN:5429246 J4 Hand SWITCH PN:5439061 PC HOST PC MONITOR Power supply connect cable and part number Angle meter LCD PN:5430986 SID POT (PN:5428673) Vertial POT(PN:5428672 ) Xray on 5428622 5428622 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Section 2.0 System Electric Assembly GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7  SCHEMATICS Section 3.0 Cable Assembly Chapter 16 - - Schematics and Drawings Page 329  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Page 330 SCHEMATICS Section 1.0 - System Schematics Chapter 16 - - Schematics and Drawings PLUG_IN_TM 1 2 1 2 3 4 5 6 PIN RIGHT_ANGLE SINGLE_ROW_BREAKAWAY 1 2 3 4 5 6 J3 E-STOP PIN RIGHT_ANGLE WIRE_TO_BOARD J2 LED_XRAY_ON LED_POWER_ON BUTTON_POWER_ON BUTTON_RESET E_STOP_H_TM 1 E_STOP_L_TM 2 VDD_5V G1 G2 G1 G2 PIN RIGHT_ANGLE STD_DENSITY 6 7 8 9 1 2 3 4 5 1 2 3 4 5 HAND_SWITCH 6 HANDSW_EXP 7 8 HANDSW_PREP 9 J1 C2 0.1U 16V 10% MH2 MH5_00_M4WASHER MH1 MH5_00_M4WASHER C1 22U 25V 20% VDD_5V C3 22U 25V 20% VDD_5V 9 10 11 12 13 14 15 G1 G2 1 2 3 4 5 6 7 8 G1 G2 BUZZER 1 2 LED_POWER_ON 3 LED_XRAY_ON 4 5 E_STOP_L_TM 6 7 8 HANDSW_EXP BUZZER MH4 MH5_00_M4WASHER MH3 MH5_00_M4WASHER C4 0.1U 16V 10% 1 2 BUZZER H1 PIN RIGHT_ANGLE STD_DENSITY_FILTERED_820PF 9 10 PLUG_IN_TM 11 E_STOP_H_TM 12 BUTTON_RESET 13 BUTTON_POWER_ON 14 HANDSW_PREP 15 J4 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Section 4.0 Console Circuit Page 331 Section 1.0 - System Schematics D C B A Tue Mar 27 AC/L AC/N FG -V -V -V +V +V +V 1 16:10:18 2012 24V-150W 1 1 2 3 4 5 6 7 8 9 1 3 5 CN3 2 4 6 AC/L AC/N TX-SERVO RX-SERVO POWER 24VA+ 24VB+ 24VA24VB- 220V 220V 2 2 PE 1 2 3 4 5 G1 G2 6 7 8 9 RELAY- POWER 3 SERVO CONTROL LINES GND-SERVO 1 2 3 4 5 P4 TO SPINE RELAY+ TX-SERVO RX-SERVO PE 24VA+ 24VB+ 24VA24VB- P2 3 4 220V 220V 1 2 3 4 5 AC/L COM CLOSED OPEN CLOSED OPEN 5 1 5 4 8 6 7 8 9 G1 G2 1 2 3 4 5 PE PE FILTER FLAC32-3A N G L LINE L' N' LOAD FLAC32-3A 24V 24V 220V 220V 24V 24V 7 P1 1 2 3 P5 POWER INPUT 1 2 3 4 220V 220V BRAKE RESISTOR U V W AC/L AC/N pdu Block Path 5 6 Block 1 of Sheet 6 7 5430980SCH Dwg No C P CN3 L1C L2C R S T 8 Rev 2 Company Sheet 8 1 of Restricted GE Healthcare 6 SERVO CONTROLLER 1 2 3 4 5 6 7 8 9 10 11 12 TO COLLIMATOR AC/L AC/N MAIN AC/L AC/N AC/N AC/L CONNNECTED TO MOTOR PE PE L' N' FILTER LINE L G N LOAD TO DETECTOR POWER PE P3 DB9 MALE 6 CTQ1:CORRECT WIRE CONNECTION BETWEEN/AMONG COMPONENTS CTQ2:24V-150W POWER REFER TO 5150458 5446299 CTQ3:12V-50W POWER REFER TO 5394097 CTQ4:SERVO CONTROLLER REFER TO 5430982 12 COM RELAY AC/L AC/N 12V+ 12V- 220V 220V DD- POWER 14 COILP 13 COILN AC/N 9 12V-50W 4 D C B A REV 2 01July04 Page 332 B Size GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Section 5.0 PDU Electric Board  GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 Galaxy PDU Schematic Initial release Approved Document - 5429118SCH_r1.pdf Page 2 of 2 1 5429118SCH Ding ZM 20Dec11 SCHEMATICS State: RELEASE - Document is released and under formal Change Control. Changes are subject to the ECR/ECO Process. See the GEHC Myworkshop System to determine the status of this document. 1.) Switch on PDU contactor. 2.) Power on PC and monitor. 3.) 1 second later, power on the Postioner and Detector. Chapter 16 - - Schematics and Drawings Page 333 ar 01 Section 1.0 - System Schematics 1 2012 C68 15P 50V 1% XTAL2 1 Y2 C56 2 10U 16V 10% 1 C59 0.1U 16V 10% VREFP 2 MH6 MHP4_00TB10_00 3 TXD1 RXD1 RELAY_CTRL COL_POT_AD ARM_POT_AD MAX485_RE_N MAX485_DE I2C0_SDA I2C0_SCL ISP LED2 MH8 MHP4_00TB10_00 MH7 MHP4_00TB10_00 4C8> 3D5 30 SPI_SCK 29 SPI_SEL 28 SPI_MISO 27 SPI_MOSI LED0 3D5< LED1 3D5 6A3> ARM_TDI ARM_TCK ARM_TMS ARM_TRST ARM_RTCK 5 3 4 6 2 75 74 73 70 69 68 67 66 65 64 53 52 51 50 4 xrayu2 Path SYM 2 OF 2 Block RTCX1 RTCX2 VBAT NC1 RSTOUT_N TDO_SWO 5 TXD2 0 0.1W +0.05 R97 0 0.1W +0.05 R96 LED5 LED4 3D5< LED3 FAN1_STATUS_MCU 0 FAN2_STATUS_MCU 1 CAL_ON 6 RXD2 RTCX2 0 3D5 4B8> 15P 50V 1% 15P 50V 1% C61 C62 9B5> 2D6 RXD2_232 2B1 RTCX1 LGH 2 of Block 4 5 TXD2_485 3 4 2 5 1 6 0 7 HANDLE_BUTTON_DOWN_MCU 7 HANDLE_BUTTON_SID_MCU 6 HANDLE_BUTTON_ROTATION_MCU5 LOCK_XXX_FDBK 4 LOCK_SID_FDBK 3 LOCK_ROT_FDBK 2 2 3 TXD2_232 C63 0.1U 16V 10% R95 ARM_JATG BUTTON_UP_MCU LSW4_MCU BUTTON_DOWN_MCU LSW3_MCU BUTTON_ROTATION_MCU LSW2_MCU BUTTON_SID_MCU LSW1_MCU LOCK_V_FDBK ARM_TDO 1 RTCX1 RTCX2 1K 0.1W 1% VDD_3V3 82 TXD3 85 RXD3 11 95 94 93 92 91 90 89 88 87 86 32 33 34 35 36 37 38 39 40 43 44 45 21 20 14 1 16 18 19 13 6 27 HANDLE_BUTTON_UP_MCU 26 GRID_IN_SENSOR_MCU VSS VSSA P2_0_PWM1_1_TXD1 P2_1_PWM1_2_RXD1 P2_2_PWM1_3_CTS1_TRACEDATA_3 P2_3_PWM1_4_DCD1_TRACEDATA_2 P2_4_PWM1_5_DSR1_TRACEDATA_1 P2_5_PWM1_6_DTR1_TRACEDATA_0 P2_6_PCAP1_0_RI1_TRACECLK P2_7_RD2_RTS1 P2_8_TD2_TXD2 P2_9_USB_CONNECT_RXD2 P3_25_MAT0_0_PWM1_2 P3_26_STCLK_MAT0_1_PWM1_3 P2_10_NEINT0_NMI P2_11_NEINT1_I2STX_CLK P2_12_NEINT2_I2STX_WS P4_28_RX_MCLK_MAT2_0_TXD3 P2_13_NEINT3_I2STX_SDA P4_29_TX_MCLK_MAT2_1_RXD3 U13 LPC1766FBD100 5 P1_0_ENET_TXD0 P1_1_ENET_TXD1 P1_4_ENET_TX_EN P1_8_ENET_CRS P1_9_ENET_RXD0 P1_10_ENET_RXD1 P1_14_ENET_RX_ER P1_15_ENET_REF_CLK P1_16_ENET_MDC P1_17_ENET_MDIO P1_18_USB_UP_LED_PWM1_1_CAP1_0 P1_19_MCOA0_NUSB_PPWR_CAP1_1 P1_20_MCI0_PWM1_2_SCK0 P1_21_NMCABORT_PWM1_3_SSEL0 P1_22_MCOB0_USB_PWRD_MAT1_0 P1_23_MCI1_PWM1_4_MISO0 P1_24_MCI2_PWM1_5_MOSI0 P1_25_MCOA1_MAT1_1 P1_26_MCOB1_PWM1_6_CAP0_0 P1_27_CLKOUT_NUSB_OVRCR_CAP0_1 P1_28_MCOA2_PCAP1_0_MAT0_0 P1_29_MCOB2_PCAP1_1_MAT0_1 P1_30_VBUS_AD0_4 P1_31_SCK1_AD0_5 SYM 1 OF 2 P0_0_RD1_TXD3_SDA1 P0_1_TD1_RXD3_SCL1 P0_2_TXD0_AD0_7 P0_3_RXD0_AD0_6 P0_4_I2SRX_CLK_RD2_CAP2_0 P0_5_I2SRX_WS_TD2_CAP2_1 P0_6_I2SRX_SDA_SSEL1_MAT2_0 P0_7_I2STX_CLK_SCK1_MAT2_1 P0_8_I2STX_WS_MISO1_MAT2_2 P0_9_I2STX_SDA_MOSI1_MAT2_3 P0_10_TXD2_SDA2_MAT3_0 P0_11_RXD2_SCL2_MAT3_1 P0_15_TXD1_SCK0_SCK P0_16_RXD1_SSEL0_SSEL P0_17_CTS1_MISO0_MISO P0_18_DCD1_MOSI0_MOSI P0_19_DSR1_SDA1 P0_20_DTR1_SCL1 P0_21_RI1_RD1 P0_22_RTS1_TD1 P0_23_AD0_0_I2SRX_CLK_CAP3_0 P0_24_AD0_1_I2SRX_WS_CAP3_1 P0_25_AD0_2_I2SRX_SDA_TXD3 P0_26_AD0_3_AOUT_RXD3 P0_27_SDA0_USB_SDA P0_28_SCL0_USB_SCL P0_29_USB_DP P0_30_USB_DN TDI TCK_SWDCLK TMS_SWDIO TRST_N RTCK VREFP VREFN XTAL1 XTAL2 RESET_N 12 15 22 23 17 VREFP XTAL1 XTAL2 10 VDDA U13 LPC1766FBD100 4 VDD_3V3 VDD_REG_3V3 VDDA 39 TXD0 38 RXD0 MOSFET_DIAG_OUT NRESET 0 MOUNTING HOLES MH4 MHP4_00TB10_00 4B4 9B8 MH2 MHP4_00TB10_00 4D3 10C8> C66 15P 50V 1% XTAL1 C58 0.1U 16V 10% 8D5< ARM_JATG C54 0.1U 16V 10% MH3 MHP4_00TB10_00 4D3 11D6 2 4 3 C57 2 10U 16V 10% 1 1 2 C55 0.1U 16V 10% MH1 MHP4_00TB10_00 8B5 GND1 GND2 VDDA C60 0.1U 16V 10% 2A6> 4B8> C73 0.1U 16V 10% C64 0.1U 16V 10% VDD_3V3_REF 2D6 C65 10U 16V 10% VDD_3V3 12MHZ C74 0.1U 16V 10% VDD_3V3_REF C72 10U 16V 10% 3 4 Y1 1 VDD_3V3 2 32.768KHZ Page 334 15:51:40 1 2 Compan GE H Rev GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Section 6.0 Spine Board ARM_JATG 6 5 4 3 2 1 0 1A6> ARM_TRST ARM_TDI ARM_TMS ARM_TCK ARM_RTCK ARM_TDO NRESET 1B1 2B5> 2B5> 2B5> 2D2> 2B2> 2B2> 3A8> R115 10K 0.125W 1% R121 10K 0.125W 1% 1 2 3 4 5 6 7 B B B B B B B Q10 ULN2003A JTAG LED5 LED4 LED3 LED2 LED1 LED0 R119 10K 0.125W 1% R120 10K 0.125W 1% 1 3 5 7 9 11 13 15 17 19 2 4 6 8 10 12 14 16 18 20 2 4 6 8 10 12 14 16 18 20 8 HSMG-C650 GREEN DS5 HSMG-C650 GREEN R89 1K 0.1W 1% DS4 HSMG-C650 GREEN R88 1K 0.1W 1% WORKING STATUS INDICATION E COM C C C C C C C 9 16 15 14 13 12 11 10 DS6 R90 1K 0.1W 1% VDD_5V PIN STRAIGHT RIBBON_CABLE_LOW_PROFILE 1 3 5 7 9 11 13 15 17 19 R110 10K 0.125W 1% LEDS DS3 HSMG-C650 GREEN R83 1K 0.1W 1% C77 0.1U 16V 10% 2 DS2 HSMG-C650 GREEN R78 1K 0.1W 1% 3 3 4 2 1 RESET_N GND DS1 HSMG-C650 GREEN R74 1K 0.1W 1% R105 499 0.1W 1% ARM_JATG PUSHBUTTON RESET MR_N VCC U16 MAX811 4 VDD_3V3 S2 KT11B1JM R127 10K 0.125W J11 1% 2 1 R118 10K 0.125W 1% 2 1 R116 10K 0.125W 1% 2 1 2 1 2 1 Chapter 16 - - Schematics and Drawings 1 3 1 1 4 2 2 VDD_3V3 0 GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Page 335 C43 10U 16V 10% VDD_3V3 Section 1.0 - System Schematics C28 15P 50V 1% 2 4 3 ISP Path if_board Block SYM 2 OF 2 P2_0_PWM1_1_TXD1 P2_1_PWM1_2_RXD1 P2_2_PWM1_3_CTS1_TRACEDATA_3 P2_3_PWM1_4_DCD1_TRACEDATA_2 P2_4_PWM1_5_DSR1_TRACEDATA_1 P2_5_PWM1_6_DTR1_TRACEDATA_0 P2_6_PCAP1_0_RI1_TRACECLK P2_7_RD2_RTS1 P2_8_TD2_TXD2 P2_9_USB_CONNECT_RXD2 P3_25_MAT0_0_PWM1_2 P3_26_STCLK_MAT0_1_PWM1_3 P2_10_NEINT0_NMI P2_11_NEINT1_I2STX_CLK P4_28_RX_MCLK_MAT2_0_TXD3 P2_12_NEINT2_I2STX_WS P4_29_TX_MCLK_MAT2_1_RXD3 P2_13_NEINT3_I2STX_SDA MH2 MHP4_00TB10_00 MOUNTING HOLES MH4 MHP4_00TB10_00 MH1 MHP4_00TB10_00 75 74 73 70 69 68 67 66 65 64 53 52 51 50 MH5 MHP4_00TB10_00 DOOR_IN_LOCK2_MCU MH6 MHP4_00TB10_00 6B6> TXD1 RXD1 E_PSW_MCU RSTOUT_N 1 0 LED0 LED1 82 TXD3 85 RXD3 27 26 VSS VSSA 6 RTCX1 RTCX2 C34 0.1U 16V 10% R37 1K 0.1W 1% VDD_3V3 LED2 LED3 Block 2 of Sheet 3C1 9 BUTTON_POWER_ON_MCU BUZZER_MCU 5D3> HANDSW_EXP_MCU LED_POWER_ON_MCU HANDSW_PREP_MCU LED_XRAY_ON_MCU BUTTON_RESET_MCU PREPARE_MCU E_STOP_H_SPINE_MCU E_STOP_H_TM_MCU ARM_TDO TR3 11 95 94 93 92 91 90 89 88 87 86 32 33 34 35 36 37 38 39 40 43 44 45 21 20 14 1 16 18 TDO_SWO 19 VBAT 13 RTCX1 RTCX2 NC1 P1_0_ENET_TXD0 P1_1_ENET_TXD1 P1_4_ENET_TX_EN P1_8_ENET_CRS P1_9_ENET_RXD0 P1_10_ENET_RXD1 P1_14_ENET_RX_ER P1_15_ENET_REF_CLK P1_16_ENET_MDC P1_17_ENET_MDIO P1_18_USB_UP_LED_PWM1_1_CAP1_0 P1_19_MCOA0_NUSB_PPWR_CAP1_1 P1_20_MCI0_PWM1_2_SCK0 P1_21_NMCABORT_PWM1_3_SSEL0 P1_22_MCOB0_USB_PWRD_MAT1_0 P1_23_MCI1_PWM1_4_MISO0 P1_24_MCI2_PWM1_5_MOSI0 P1_25_MCOA1_MAT1_1 P1_26_MCOB1_PWM1_6_CAP0_0 P1_27_CLKOUT_NUSB_OVRCR_CAP0_1 P1_28_MCOA2_PCAP1_0_MAT0_0 P1_29_MCOB2_PCAP1_1_MAT0_1 P1_30_VBUS_AD0_4 P1_31_SCK1_AD0_5 SYM 1 OF 2 P0_0_RD1_TXD3_SDA1 P0_1_TD1_RXD3_SCL1 P0_2_TXD0_AD0_7 P0_3_RXD0_AD0_6 P0_4_I2SRX_CLK_RD2_CAP2_0 P0_5_I2SRX_WS_TD2_CAP2_1 P0_6_I2SRX_SDA_SSEL1_MAT2_0 P0_7_I2STX_CLK_SCK1_MAT2_1 P0_8_I2STX_WS_MISO1_MAT2_2 P0_9_I2STX_SDA_MOSI1_MAT2_3 P0_10_TXD2_SDA2_MAT3_0 P0_11_RXD2_SCL2_MAT3_1 P0_15_TXD1_SCK0_SCK P0_16_RXD1_SSEL0_SSEL P0_17_CTS1_MISO0_MISO P0_18_DCD1_MOSI0_MOSI P0_19_DSR1_SDA1 P0_20_DTR1_SCL1 P0_21_RI1_RD1 P0_22_RTS1_TD1 P0_23_AD0_0_I2SRX_CLK_CAP3_0 P0_24_AD0_1_I2SRX_WS_CAP3_1 P0_25_AD0_2_I2SRX_SDA_TXD3 P0_26_AD0_3_AOUT_RXD3 P0_27_SDA0_USB_SDA P0_28_SCL0_USB_SCL P0_29_USB_DP P0_30_USB_DN TDI TCK_SWDCLK TMS_SWDIO TRST_N RTCK U8 LPC1766FBD100 46 47 98 99 81 80 79 78 77 DOWNLOAD 76 48 1 TXD2 0 RXD2 49 62 63 61 60 59 58 57 56 9 LED4 8 LED5 7 6 1 I2C0_SDA 25 0 I2C0_SCL 24 29 30 2 5 3 4 100 12 15 22 23 17 VREFP VREFN XTAL1 XTAL2 NRESET ARM_TDI ARM_TCK ARM_TMS ARM_TRST ARM_RTCK VREFP VREFN XTAL1 XTAL2 RESET_N 10 VDDA XTAL1 4D7> 4B5 12MHZ Y1 1A8> C24 0.1U 16V 10% U8 LPC1766FBD100 5 RTCX2 5B6> 32.768KHZ 4A5> 4C2> 5D4> 5D3> 15P 50V 1% 15P 50V 1% C46 C40 5433255SCH Dwg No 4B5> 5B6> 5B6> 5B6> RTCX1 7 4 4 VDD_3V3 VDD_REG_3V3 VDDA DOOR_IN_LOCK1_MCU TXD0 3B2< RXD0 1 EXPOSURE_MCU EP 0 PSW_MCU PLUG_IN_MCU 6B5> 6B6> 3B2> 3C2 2D3 VDDA C49 0.1U 16V 10% VREFN C44 0.1U 16V 10% 0.1U 16V 10% 3 4C7> C39 0.1U 16V 10% 1B6 C56 0.1U 16V 10% VREFP C26 0.1U 16V 10% XTAL2 1 C45 0.1U 16V 10% C53 10U 16V 10% VDD_3V3 C25 10U 16V 10% VDD_3V3 C48 10U 16V 10% VDD_3V3 C52 Y2 Page 336 1 2 2 Company Sh R GE Heal Rev GE HEALTHCARE DIRECTION 5429575-CA-1EN, REVISION 7 SCHEMATICS  Section 7.0 IF Board Chapter 16 - - Schematics and Drawings 1 2 3 4 5 6 7 4C7> B B B B B B B Q4 ULN2003A 1A8> 2 8 9 16 15 14 13 12 11 10 R61 10K 0.125W 1% HSMG-C650 GREEN HSMG-C650 GREEN DS6 R25 1K 0.1W 1% 3 1 3 5 7 9 11 13 15 17 19 2 4 6 8 10 12 14 16 18 20 2 4 6 8 10 12 14 16 18 20 HSMG-C650 GREEN DS5 R20 1K 0.1W 1% LEDS HSMG-C650 GREEN DS4 R18 1K 0.1W 1% 4 HSMG-C650 GREEN DS3 R16 1K 0.1W 1% PIN STRAIGHT RIBBON_CABLE_LOW_PROFILE R60 10K 0.125W 1% 1 3 5 7 9 11 13 15 17 19 R65 10K 0.125W J7 1% JTAG HEADER R63 10K 0.125W 1% R64 10K 0.125W 1% WORKING STATUS INDICATION E COM C C C C C C C DS7 R26 1K 0.1W 1% VDD_5V 2 1 R59 10K 0.125W 1% 2 1 R62 10K 0.125W 1% 2 1 Document - 5433255SCH r2 pdf Page 4 of 10 2012 LED0 LED1 LED2 LED3 LED4 LED5 1A2 1A2 1B2

Control arms help to keep the wheels in proper alignment and the bushings reduce vibration and noise from road surfaces. The mounting hardware secures the arms ...

P/N 5110612. GE MRI Driver Module (excite) | Part Number: 5110612 · Get a Quote. REQUEST A QUOTE/CONTACT US @ (866) 530-7850. Part Number (required). Your Name ...

The Power Supply Assembly 12V DC 16-Slice is used in the Computed Tomography (CT) machines, Magnetic Resonance Imaging (MRI) machines and many other Digital ...

2118408-3 - Backplane Power Supply Signa LX 1.5T - MRI. 2120458-3 - Cable MG2 ... Signa 1.5T, Signa Contour - MRI. 2160818-7-H - IPGII Sun Style Front ...

Multislice CT Scan 16 Slice GE Brivo CT385 China NAME OF PRODUCT BRAND / MANUFACTURER MODEL / TYPE FACTORY OF ORIGIN R

2423192 Rev. 7 – Block, 1.5T 16 Channel HNS ... MGD Chassis, GE, MRI. 2303520, Diode Board, GE, MRI ... B Bezel and Harness Assembly, 8 Channel, GE, MRI.

RF Transmitter Switch 2254635 GE, Discovery MR450, Signa Excite 1.5T 11X. Tested Medical Equipment Spare Parts for Sale, Worldwide Shipping.